SecReT4
Protein ID: 285018612
T4SS name [ID]VirB [216]
Gene symbolvirB8
Locus tagXALc_1842
StrainXanthomonas albilineans GPE PC73
Repliconchromosome [GenBank: NC_013722] [Browse all T4SS(s) in this replicon]
Location [Strand]2164429..2165403 [-]
Producttype IV secretion system protein Virb8
Component typeVirB8
UniProt IDD2UE06
KEGG IDxal:XALc_1842
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 2e-50, Aligned region: 18..240
Protein Sequence: 324 a.a.     [Download]
>gi|285018612|ref|YP_003376323.1| type IV secretion system protein Virb8 [Xanthomonas albilineans GPE PC73]
MFGKNPIESESVNKTVAKAVNYEVSIADLARRSERRAWWVAFSAIILCLLLGGGYYYMLPLKEKVPYLVM
ADAYTGNSTVSVLRDIGDVRSITTSEALARSNVARFIAARESYDSEMMALNDWSTVFSMAPKDTSVGEEY
YALHAPNNPSAPYYTYGRTRSIRVAILSITLQGGGGKPYDGANVRFQRSIYDKKSGQSTLLDNKFAILGF
RYNNNLVMNEDLRVQNPLGFQVTDYRVDNDYSAMPVPPSPSFQSPTVSALQSHTAGSTAGQPSMTGGSGG
APAQQQMPAANPGSAPVYPAAQPVPVPSAPNVAPQNNGNGANVR
 
Nucleotide Sequence: 975 bp     [Download]
>gi|285016821|ref|NC_013722.1|:c2165403-2164429 Xanthomonas albilineans GPE PC73 chromosome, complete genome
ATGTTTGGTAAAAATCCCATTGAGAGCGAGAGCGTTAACAAAACTGTTGCGAAGGCGGTTAATTACGAGG
TCAGTATTGCTGATTTGGCACGGCGCAGCGAGCGTCGTGCGTGGTGGGTCGCGTTCAGTGCAATTATCCT
GTGCTTGTTGCTCGGTGGCGGTTACTACTACATGCTGCCGCTGAAGGAAAAGGTTCCCTACCTGGTGATG
GCAGATGCGTATACCGGTAACTCGACGGTGTCGGTGTTGCGGGATATCGGTGACGTTAGGAGCATCACTA
CCAGCGAGGCGTTGGCCAGAAGTAATGTCGCCAGATTCATTGCTGCAAGGGAGTCCTATGACTCCGAGAT
GATGGCCCTGAACGACTGGTCGACAGTGTTTTCGATGGCGCCAAAAGATACTTCGGTGGGAGAAGAGTAC
TATGCGTTGCATGCGCCAAATAATCCATCGGCGCCATATTATACTTACGGCAGGACGCGATCCATTCGTG
TGGCGATCCTGAGTATTACCCTGCAAGGTGGCGGTGGAAAGCCGTATGACGGCGCGAATGTTCGCTTCCA
GCGCAGTATCTATGATAAAAAAAGTGGGCAGTCTACTTTATTAGATAATAAATTCGCTATCCTGGGTTTT
CGTTATAATAATAACCTGGTGATGAATGAAGATCTTCGCGTGCAAAACCCGTTGGGTTTCCAGGTGACAG
ATTATCGAGTCGATAACGATTACTCGGCGATGCCGGTGCCGCCATCGCCGTCCTTTCAGTCGCCGACGGT
GAGCGCGCTGCAGTCGCATACGGCTGGATCGACAGCCGGACAGCCTTCTATGACTGGTGGCAGTGGGGGG
GCTCCTGCCCAGCAGCAGATGCCGGCTGCAAACCCTGGTAGTGCACCTGTTTATCCGGCGGCGCAACCTG
TTCCTGTCCCGTCTGCGCCCAATGTTGCACCCCAGAACAATGGCAATGGAGCGAATGTTCGATGA
 Primer design