SecReT4
Protein ID: 285018637
T4SS name [ID]VirB [216]
Gene symbolvirB6-1
Locus tagXALc_1867
StrainXanthomonas albilineans GPE PC73
Repliconchromosome [GenBank: NC_013722] [Browse all T4SS(s) in this replicon]
Location [Strand]2186528..2187640 [-]
Producttype IV secretion system protein Virb6
Component typeVirB6
UniProt IDD2UE08
KEGG IDxal:XALc_1867
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 2.8e-31, Aligned region: 60..291
Protein Sequence: 370 a.a.     [Download]
>gi|285018637|ref|YP_003376348.1| type IV secretion system protein Virb6 [Xanthomonas albilineans GPE PC73]
MSMFDGSMNWLHPLADTSLGDYVFFRLINNYLSNQIDTFGMDVMARAMQWVSVIALTATTFWVLLLGYRI
ASGQLRESAMATMIKAGKVTVILGIAAGIGANGTMLHKTMTDGLDKEIHWLFTGQKDSTAADAIDENLAY
TQLALSTLDAVQVDARDTEAIEQKGRALLMAGFGTAGPPIMAGVMLLMFKFTMAFLIGVGPIFILFLIFD
QTKDLFKRWLFYVIGTLFSMSVLSVVTAIALKMTARIAAAYWGAKIISLGNAEGLSSQALQQGWAGLIAT
TLIVVLPPIGAVLWQGSMANFMHFSVFNPASVPGPQGQPPGSYTPPQARENTSNASREQSGISQTPVRFK
GPESTQSTHPPGSRGQAGKD
 
Nucleotide Sequence: 1113 bp     [Download]
>gi|285016821|ref|NC_013722.1|:c2187640-2186528 Xanthomonas albilineans GPE PC73 chromosome, complete genome
ATGAGCATGTTCGATGGATCGATGAACTGGTTACACCCCTTGGCGGACACAAGCCTGGGGGATTACGTCT
TCTTCCGGCTGATCAACAACTACCTCAGTAACCAGATCGACACCTTCGGCATGGACGTGATGGCCCGCGC
CATGCAGTGGGTAAGTGTCATCGCGCTGACCGCCACCACCTTCTGGGTGCTGTTGCTAGGCTATCGCATC
GCCAGCGGGCAATTACGCGAATCGGCCATGGCGACCATGATCAAGGCCGGCAAGGTGACGGTGATCCTGG
GCATTGCCGCCGGGATAGGCGCCAACGGCACGATGCTGCATAAAACCATGACCGACGGCCTGGACAAGGA
AATCCATTGGCTGTTCACCGGTCAGAAGGACAGCACCGCCGCCGACGCCATCGACGAGAACCTCGCCTAC
ACCCAATTGGCGCTGAGCACCTTGGACGCGGTGCAGGTGGACGCGCGCGACACGGAAGCCATCGAGCAGA
AAGGCCGCGCGCTGCTGATGGCCGGCTTCGGCACCGCCGGTCCGCCGATCATGGCCGGGGTGATGCTGCT
GATGTTCAAATTCACCATGGCCTTCCTGATCGGGGTGGGACCGATCTTCATCCTGTTCCTGATCTTCGAC
CAGACCAAGGACCTGTTCAAACGTTGGTTGTTCTACGTGATCGGCACACTGTTCTCGATGTCGGTGCTGT
CGGTAGTCACGGCGATCGCATTGAAGATGACGGCGAGGATCGCGGCGGCCTACTGGGGAGCGAAGATCAT
CTCGCTAGGCAATGCGGAAGGCTTGTCTTCGCAGGCATTGCAGCAGGGGTGGGCAGGGTTGATCGCCACC
ACACTGATCGTCGTCCTACCCCCGATTGGGGCTGTATTGTGGCAGGGCAGCATGGCCAACTTCATGCACT
TCTCCGTCTTCAATCCCGCCTCGGTCCCAGGACCACAGGGGCAACCGCCTGGTTCGTATACGCCGCCGCA
AGCAAGAGAAAACACTTCTAATGCCTCGCGCGAGCAGTCAGGAATCTCTCAAACACCAGTCAGATTCAAA
GGCCCTGAATCTACCCAATCCACGCACCCTCCCGGCTCACGTGGACAAGCTGGGAAAGACTGA
 Primer design