SecReT4
Protein ID: 28558891
T4SS name [ID]VirB [454]
Gene symbol-
Locus tagrc164
StrainRuegeria sp. PR1b plasmid pSD25 (NC_004574)
Repliconplasmid pSD25 [GenBank: NC_004574] [Browse all T4SS(s) in this replicon]
Location [Strand]72097..72750 [+]
ProductRC164
Component typeVirB8
UniProt IDQ8KW26
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam VirB8 [PF04335], Evalue: 1.8e-41, Aligned region: 6..211
Protein Sequence: 217 a.a.     [Download]
>gi|28558891|ref|NP_788151.1| RC164 [Ruegeria sp. PR1b]
MASEQEIIEEELVYGALRRERLWQRLGLIGLIFGILGCLSAATVAILDVDPPPVVVPYDPATGFALPEAS
VGASSVTANQAIIEAEVFRYVTDREVYNQLDNDLRIRSVLRRSDGAAESGLRQIWNSANENYPPTVYGPN
ARLDVEILSINRIGTNRATVRLRKRLTSINGVQTGLFTATLLFEFRPETRRSIDEVWTNPFGFTVLEYSI
RSDRLEN
 
Nucleotide Sequence: 654 bp     [Download]
>gi|28558826|ref|NC_004574.1|:72097-72750 Ruegeria sp. PR1b plasmid pSD25, complete sequence
GTGGCGAGTGAACAAGAAATCATCGAAGAAGAGCTGGTCTATGGTGCACTGCGCCGCGAACGGCTCTGGC
AGCGCCTTGGGCTCATCGGGCTCATCTTCGGCATTCTCGGATGCCTGAGCGCGGCGACTGTCGCAATTCT
CGATGTCGATCCGCCGCCTGTGGTCGTGCCCTATGATCCCGCCACCGGCTTTGCACTCCCCGAAGCCTCG
GTGGGCGCCTCCTCGGTGACCGCCAACCAGGCGATCATCGAGGCGGAAGTCTTCCGCTATGTGACCGACC
GGGAGGTCTACAACCAGCTAGACAACGATCTGCGCATCCGCAGCGTCCTGCGCCGCTCGGACGGAGCTGC
CGAGAGCGGGCTGCGCCAGATCTGGAACAGCGCCAATGAGAACTACCCGCCGACGGTCTATGGCCCCAAT
GCTCGGCTCGACGTGGAGATCCTCAGCATCAACCGGATCGGAACCAACCGCGCGACGGTCCGCCTGCGCA
AGCGCCTGACATCTATCAACGGCGTCCAAACCGGGCTTTTCACCGCCACCCTCCTTTTCGAGTTCCGCCC
CGAGACCCGCCGCTCCATCGACGAGGTCTGGACCAACCCCTTCGGCTTCACGGTCCTCGAATATTCCATC
CGCTCCGACAGATTGGAGAACTGA
 Primer design