SecReT4
Protein ID: 28558894
T4SS name [ID]VirB [454]
Gene symbol-
Locus tagrc167
StrainRuegeria sp. PR1b plasmid pSD25 (NC_004574)
Repliconplasmid pSD25 [GenBank: NC_004574] [Browse all T4SS(s) in this replicon]
Location [Strand]74766..75815 [+]
ProductRC167
Component typeVirB11
UniProt IDQ8KW23
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 4.3e-57, Aligned region: 37..327
Protein Sequence: 349 a.a.     [Download]
>gi|28558894|ref|NP_788154.1| RC167 [Ruegeria sp. PR1b]
MSIRAPASRSWSTAIWRYSEPMSLSYLQTSLDRIDAAARDDVIEICINPDGTCWGEFQGDHFMRKLDQKL
TATEVKDLGNQIASSANTMMSKDRPIVSVSITYKGRPIRAQVITPPAVLSAMSISLRFFSSLPLEGIALD
FLFGKERKLEELRLEKTRELREVVAAGVIDDALAFCVDNKLNMIVSGGTSTGKTVAARKILSHVPSEERI
VTIEEAAELLPTQPNAVTLIANRDAEFQTADVLLTATLRMRPDRIILGEVRGKEAMTFLEAINTGHGGSM
TTLHAETPQLAVQRLAIAALKTEIPMTYADMIQYIENSIDVIIQAGRHDGKRGITEFYLPGADQIGASQ
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|28558826|ref|NC_004574.1|:74766-75815 Ruegeria sp. PR1b plasmid pSD25, complete sequence
ATGTCGATCAGGGCGCCCGCGTCACGGTCATGGTCGACCGCGATCTGGAGATATTCTGAGCCCATGTCGC
TGAGCTATCTTCAAACCTCGCTCGACCGGATCGACGCCGCCGCCCGCGACGATGTCATCGAGATTTGCAT
CAACCCAGACGGAACCTGCTGGGGCGAGTTCCAGGGCGATCACTTCATGAGAAAGCTGGACCAGAAGCTG
ACAGCAACCGAAGTGAAGGACCTCGGCAACCAGATCGCCTCCTCTGCCAACACCATGATGAGCAAGGACC
GCCCCATCGTCTCGGTCTCGATCACTTACAAGGGCCGTCCGATCCGCGCACAGGTCATCACCCCGCCTGC
CGTGCTCTCGGCCATGTCGATCAGCCTTCGGTTCTTCTCAAGCCTGCCGCTCGAGGGAATTGCGCTTGAT
TTCCTTTTTGGCAAGGAACGCAAGCTTGAAGAACTCCGCCTCGAGAAAACCCGCGAACTGCGCGAGGTCG
TGGCTGCAGGCGTCATCGACGATGCCCTGGCCTTCTGCGTCGACAATAAGCTCAACATGATCGTCTCGGG
CGGCACCTCCACCGGCAAGACCGTCGCCGCGCGGAAGATCCTCTCACACGTACCATCCGAGGAACGCATC
GTCACCATCGAGGAAGCCGCCGAGCTTCTGCCGACCCAGCCCAATGCCGTGACCCTCATCGCCAATCGCG
ATGCGGAGTTCCAGACCGCCGATGTGCTGCTCACCGCAACGTTGCGCATGCGCCCCGACCGGATCATCCT
GGGCGAGGTGCGCGGCAAGGAGGCCATGACCTTCCTTGAGGCGATCAACACGGGCCATGGCGGGTCCATG
ACCACGCTCCATGCCGAAACCCCGCAACTCGCCGTGCAGCGGCTCGCGATCGCCGCGCTCAAAACCGAGA
TCCCGATGACCTATGCCGACATGATCCAGTACATCGAGAACTCCATCGATGTGATCATCCAGGCCGGTCG
GCATGACGGCAAACGCGGCATCACCGAATTTTACCTCCCCGGCGCAGACCAGATCGGAGCTTCCCAATGA
 Primer design