SecReT4
Protein ID: 28558899
T4SS name [ID]VirB [454]
Gene symbol-
Locus tagrc172
StrainRuegeria sp. PR1b plasmid pSD25 (NC_004574)
Repliconplasmid pSD25 [GenBank: NC_004574] [Browse all T4SS(s) in this replicon]
Location [Strand]82508..84508 [-]
ProductRC172
Component typeVirD4
UniProt IDQ8KW18
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T4SS-DNA_transf [PF02534], Evalue: 2.1e-86, Aligned region: 127..541
TraG-D_C [PF12696], Evalue: 4.2e-28, Aligned region: 386..507
TrwB_AAD_bind [PF10412], Evalue: 1.4e-17, Aligned region: 135..521
AAA_10 [PF12846], Evalue: 2e-08, Aligned region: 134..467
Protein Sequence: 666 a.a.     [Download]
>gi|28558899|ref|NP_788159.1| RC172 [Ruegeria sp. PR1b]
MGKARIATGVLLVTLVTGAIGYTIASAVLTYQDLGFGAKIDFAYIAQNYLAILDRRPEDAQLIHLIIGSF
AAAGLMLSLALSGSALTRFGQTHWQSAREMKANGFFGAPGTGFILGKLGPPGSRANYICSKVFPHALIVA
PTGRGKTTGFVIPNLLTWQGSAVTLDVKGECFEATARHRAAQGDKVYRFAPTDWEGKRTHRYNPLLRIFE
LKDPARQQMELQLLATLFLQSDNDRVQGLLKGGIDLFVAAGLLAFQRKRPTLGEIYRIAASGGNKQKEYF
ARGHEVDNRAAKLIFTRLASTNNDTLTSYVSLLMTSGLDQWQNPAIDEATAVSDFDFRTIRKKPFSVYLV
VQPLMVKPLAPLIRLFFSDLLSAMQEKDPGPDEPWPVMIMLDEFNRLGKMPIVVESIETLRTYRGHLAVV
TQTIPALDEIYGENTRRALQGNAGVKLYLTPSDEKTVEELSKAVGKTTKTVITRSQSIGKNPFEGRSQST
RTEESSLLPEDEARRLPLDEIVMVIDAQMPVRAKRIQYFDDRLFKAIHAAQTGELPFPKPGGGRAQGDLP
LSVRAMPMTPPANGSGGPEADLEAARRAADGQSSGQTDVTPKKTAPVVQAVIAEEQRQMEMDFGSSVVDS
EAASVADEAQMRSAVDGLDDMEAMLREEDGERLVAR
 
Nucleotide Sequence: 2001 bp     [Download]
>gi|28558826|ref|NC_004574.1|:c84508-82508 Ruegeria sp. PR1b plasmid pSD25, complete sequence
ATGGGAAAGGCGCGGATCGCCACAGGGGTCTTGCTGGTAACGCTGGTGACCGGTGCGATAGGCTACACCA
TCGCCTCGGCGGTGCTGACCTACCAGGATCTCGGCTTCGGGGCCAAGATCGACTTCGCCTATATCGCGCA
AAACTATCTGGCGATCCTGGACCGCCGCCCGGAGGACGCCCAACTTATTCACTTGATCATCGGCAGCTTC
GCCGCCGCCGGCCTGATGCTGAGCCTCGCCCTCTCAGGATCGGCGCTCACACGCTTTGGCCAGACCCATT
GGCAGAGTGCGCGCGAGATGAAGGCCAACGGGTTCTTCGGGGCGCCGGGCACCGGGTTCATCCTCGGTAA
GCTCGGGCCGCCGGGCTCCCGCGCCAATTACATCTGCTCGAAAGTTTTCCCCCATGCGCTGATTGTGGCG
CCCACGGGCCGCGGCAAGACCACGGGCTTTGTCATTCCGAACCTGCTGACCTGGCAAGGCTCCGCCGTGA
CGCTCGATGTGAAGGGGGAATGTTTCGAAGCCACGGCCCGTCACCGCGCCGCCCAAGGCGACAAGGTTTA
CCGCTTTGCCCCCACCGATTGGGAGGGCAAGCGCACGCATCGCTACAACCCGCTCTTGCGCATCTTCGAA
CTGAAAGATCCCGCGCGCCAGCAGATGGAATTGCAGCTTCTCGCGACGCTCTTCTTGCAGAGCGACAACG
ATCGGGTGCAGGGCCTCCTCAAAGGCGGGATCGATCTTTTCGTCGCGGCGGGGCTTTTGGCGTTCCAGCG
CAAGCGCCCCACCCTTGGTGAAATCTACCGCATCGCCGCTTCGGGCGGGAACAAGCAGAAGGAATATTTC
GCGCGGGGCCATGAGGTCGACAACAGGGCGGCCAAGTTGATCTTCACGCGGCTCGCCTCGACCAACAACG
ACACGCTGACGTCTTACGTTTCGCTCCTGATGACCTCGGGGCTTGACCAATGGCAGAACCCGGCGATCGA
TGAGGCGACAGCGGTCTCGGACTTTGATTTCCGTACGATCCGCAAGAAGCCCTTCTCGGTCTACCTCGTC
GTCCAGCCGCTGATGGTGAAGCCGCTGGCGCCGCTGATCCGGCTCTTTTTCTCCGATCTCCTTTCCGCCA
TGCAGGAAAAGGATCCCGGGCCGGATGAGCCGTGGCCGGTGATGATCATGCTCGACGAGTTCAACCGTTT
GGGAAAGATGCCCATCGTGGTCGAGAGCATCGAGACACTGCGGACCTATCGCGGTCACCTGGCCGTGGTC
ACCCAAACCATCCCCGCCCTCGACGAAATCTATGGTGAGAACACTCGGCGCGCCCTGCAGGGCAATGCCG
GCGTGAAGCTCTACCTGACGCCCTCGGATGAGAAAACGGTCGAGGAGCTCAGCAAGGCTGTCGGCAAGAC
TACGAAAACCGTCATCACGCGATCCCAGTCCATCGGCAAGAACCCCTTCGAGGGCCGCAGCCAATCCACA
CGGACCGAAGAAAGTTCCTTGCTGCCTGAAGATGAGGCGCGCCGTCTGCCGCTCGACGAGATCGTCATGG
TGATCGATGCACAAATGCCGGTTCGGGCCAAACGGATTCAGTATTTTGACGACCGGCTCTTCAAGGCGAT
CCATGCGGCACAAACGGGCGAGTTGCCGTTTCCGAAGCCGGGGGGAGGGAGAGCACAAGGTGATTTGCCG
CTGAGTGTGCGCGCCATGCCGATGACTCCGCCAGCGAACGGGTCAGGCGGACCCGAGGCCGACCTTGAGG
CCGCACGCCGGGCTGCTGATGGCCAATCGTCAGGGCAAACCGATGTCACCCCAAAGAAGACTGCGCCTGT
CGTTCAAGCCGTTATCGCAGAGGAACAGCGACAGATGGAGATGGATTTTGGCAGCAGCGTTGTGGATTCT
GAAGCTGCGAGCGTAGCTGATGAGGCGCAGATGCGCTCTGCAGTCGATGGCTTGGACGACATGGAAGCGA
TGCTGCGAGAGGAGGATGGTGAAAGGCTGGTTGCGCGATAG
 Primer design