SecReT4
Protein ID: 28868069
T4SS name [ID]Tfc [761]
Gene symbol-
Locus tagPSPTO_0848
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T4SS(s) in this replicon]
Location [Strand]916412..917785 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDQ889B3
KEGG IDpst:PSPTO_0848
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 457 a.a.     [Download]
>gi|28868069|ref|NP_790688.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MRRAAMLTIAIMSALTVNSALAETPGISASSSGSVIGDDVLYSVGGGNAVTMGSAGNMDSISIGGGWNSN
LVCGNMSLNNTLENQLNGTTSGFQTIMGSMISNATSAVASLPGLIIQRANPALYNLLTNGILQGRLDFDR
SKGTCRAIADKMLDVAGGQMGWYKIAEGQAMSQAVKTGNTDAVSAVAQVEKQGGNDGITWVGGSKAGGSG
QQPIKVVGDVTRAGYNLLNGRNAADTASISPSSCNNGMVCSIWPSPQEATTFANRVLGEQQQRTCEGCNK
TTSTAGVGLTPLIQESYDSKLKALQELISGNKSLTQENLSQASSSSLPVTRGVVEALRSEHDQDILAKRL
ASELALSDVLGKALLLQRTLFTGSKEPNIAANDVAQQAVSQQNNNLQQEIDNLKTELDMRRNLASNSPTA
ILQRAQIRRDGSKGIFQGDPTPDRLDQLQNPAKGNAP
 
Nucleotide Sequence: 1374 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c917785-916412 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGCGCCGCGCCGCCATGTTGACTATCGCAATCATGAGCGCCCTGACGGTAAACAGCGCCCTTGCCGAGA
CGCCAGGGATCAGTGCCAGCTCGTCCGGCAGCGTCATCGGTGATGATGTGTTGTACAGCGTCGGTGGCGG
CAACGCCGTGACCATGGGAAGCGCCGGGAACATGGACAGCATCAGCATTGGCGGTGGCTGGAACAGTAAC
CTGGTCTGCGGAAACATGAGCCTGAACAATACACTGGAGAATCAGTTGAACGGTACCACTTCCGGCTTTC
AGACGATCATGGGCTCGATGATCTCCAACGCCACCAGCGCGGTGGCTTCATTGCCAGGGCTGATTATCCA
GCGCGCCAATCCAGCGCTTTACAACCTGCTCACCAACGGCATCCTGCAAGGCCGTCTTGATTTCGACCGT
TCCAAAGGCACGTGCCGCGCCATAGCGGACAAGATGCTCGATGTCGCGGGCGGACAAATGGGCTGGTACA
AGATCGCCGAAGGCCAGGCCATGAGTCAGGCAGTGAAAACCGGAAACACAGACGCGGTCTCAGCCGTTGC
TCAGGTCGAAAAGCAAGGTGGGAATGACGGTATCACCTGGGTGGGTGGAAGCAAGGCCGGCGGATCGGGC
CAGCAACCGATCAAGGTCGTAGGCGATGTCACTCGGGCAGGATACAACCTGCTGAACGGACGTAATGCCG
CTGATACAGCGTCTATCAGCCCATCGAGCTGCAACAACGGCATGGTGTGCTCTATCTGGCCTTCGCCGCA
GGAAGCAACCACATTCGCCAACCGTGTTCTGGGAGAGCAGCAACAGCGCACGTGTGAGGGTTGCAACAAA
ACCACCTCCACTGCTGGCGTTGGGCTCACGCCCCTCATTCAAGAGTCCTACGACTCAAAACTCAAGGCAC
TGCAGGAGCTCATTTCAGGCAACAAGTCCCTCACGCAGGAGAACCTGTCGCAAGCCAGCAGTAGCTCTCT
GCCTGTGACGCGTGGCGTGGTCGAGGCCCTTCGTTCCGAACACGACCAGGACATATTGGCCAAACGCCTT
GCTTCAGAGCTCGCTTTATCGGATGTGCTGGGCAAAGCGTTGCTGCTTCAACGCACCCTGTTTACCGGAA
GCAAGGAACCGAACATCGCCGCCAATGATGTGGCCCAGCAGGCGGTCAGTCAGCAGAACAACAACCTGCA
ACAGGAAATTGACAACCTGAAGACCGAGCTGGACATGCGGCGCAATCTGGCCAGCAACTCTCCGACAGCC
ATTCTCCAACGGGCTCAAATCAGGAGAGACGGTTCAAAAGGCATCTTCCAAGGCGACCCGACGCCTGATC
GTCTTGACCAGTTGCAAAATCCTGCGAAAGGAAACGCACCATGA
 Primer design