SecReT4
Protein ID: 28868070
T4SS name [ID]Tfc [761]
Gene symbol-
Locus tagPSPTO_0849
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T4SS(s) in this replicon]
Location [Strand]917806..918744 [-]
Producthypothetical protein
Component typeTfc23
UniProt IDQ889B2
KEGG IDpst:PSPTO_0849
PDB IDNA
Domain hit(s) vs Pfam TraU [PF06834], Evalue: 9.1e-94, Aligned region: 31..300
Protein Sequence: 312 a.a.     [Download]
>gi|28868070|ref|NP_790689.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MNLRKPSAWTALALSISTGPAAAGTVTSATLAASTLSPDCLEYKVVGICYWLLCTPFGCKVKTSTKVRHY
VPDAVVSSYSNTGENPWVEVSSLSSPTSFAQDGGDGTTSHNNEDNLAKFKNTDVIGHPGGATFSKFASAS
GYACQGAATPYMPYLLSTLDTIAWRYGVPESAYPEALIPGQREVGGLTSGDMWGSLYPRSGFIHQADDYK
AAAVIAQRAGDVVTRRGQIHIYQPLLAKPQSGYWPAGELIETDASTGKWQELTPTLSQSCAVFPNSQPRV
QATDGGYAWALWRPYSCCKRQGQTFLGSTDFQ
 
Nucleotide Sequence: 939 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c918744-917806 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGAACCTGCGCAAGCCTTCGGCATGGACGGCCTTGGCCCTGTCGATCTCGACCGGGCCAGCCGCCGCCG
GTACAGTGACCTCGGCCACCCTCGCCGCCTCAACCCTGTCGCCTGACTGCCTGGAGTACAAGGTGGTCGG
CATATGCTACTGGCTGCTCTGCACGCCGTTTGGCTGCAAGGTCAAGACGTCGACCAAGGTTCGACATTAT
GTTCCCGACGCGGTTGTATCGAGCTACTCGAACACTGGGGAAAACCCTTGGGTCGAAGTCTCTTCGCTGA
GTTCACCCACTTCATTCGCCCAGGATGGCGGCGACGGAACCACCAGCCACAACAACGAAGACAACCTGGC
CAAATTCAAAAACACTGACGTCATTGGCCACCCCGGGGGAGCTACGTTCAGTAAGTTTGCCAGCGCTTCG
GGGTATGCCTGTCAGGGTGCTGCGACCCCCTACATGCCTTACCTGCTGAGCACGCTGGACACCATCGCCT
GGCGTTATGGTGTTCCAGAATCAGCCTATCCCGAAGCCCTGATTCCCGGTCAGCGAGAGGTGGGCGGTCT
CACCTCGGGGGACATGTGGGGAAGCCTTTATCCCCGTAGTGGTTTTATCCATCAAGCCGACGATTACAAG
GCAGCGGCCGTGATCGCGCAGCGCGCTGGTGACGTGGTCACTCGCCGCGGTCAGATTCACATCTATCAAC
CCCTTCTGGCAAAACCTCAGTCAGGCTACTGGCCTGCTGGGGAATTGATCGAGACCGACGCCAGCACCGG
TAAGTGGCAAGAGCTCACGCCGACCCTCAGTCAAAGCTGTGCGGTATTCCCGAACTCGCAGCCCCGTGTG
CAGGCGACCGATGGCGGTTATGCCTGGGCGCTATGGCGACCCTATTCCTGCTGCAAGCGGCAAGGACAAA
CTTTTCTTGGCAGTACGGACTTTCAATGA
 Primer design