SecReT4
Protein ID: 28868071
T4SS name [ID]Tfc [761]
Gene symbol-
Locus tagPSPTO_0850
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T4SS(s) in this replicon]
Location [Strand]918744..919160 [-]
Producthypothetical protein
Component typeTfc24
UniProt IDQ889B1
KEGG IDpst:PSPTO_0850
PDB IDNA
Domain hit(s) vs Pfam DUF1525 [PF07511], Evalue: 8.7e-36, Aligned region: 17..124
Protein Sequence: 138 a.a.     [Download]
>gi|28868071|ref|NP_790690.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MAFLILIAAIQVPFANAETWIVTDRNHPVQAPARVRLILLDESERLEAKFSEGLPANQQQAIVIMQQRLK
SADAQRLQRDQQNLVDAWSIGVTKVPAVVVDRTFVVYGETNVLAAEQRIAQWRAAAHHQDEAGQGDIP
 
Nucleotide Sequence: 417 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c919160-918744 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGGCCTTCCTGATCTTGATTGCGGCCATACAGGTCCCCTTCGCGAACGCGGAGACGTGGATCGTTACTG
ACCGGAACCACCCAGTTCAGGCACCGGCACGTGTCCGGCTGATCCTCCTGGACGAATCAGAAAGGCTTGA
GGCCAAGTTCTCTGAAGGATTGCCAGCGAATCAGCAGCAGGCCATTGTGATCATGCAGCAACGCCTCAAG
AGCGCCGATGCGCAGCGCTTGCAACGCGACCAACAAAACCTCGTAGACGCCTGGAGCATTGGGGTCACGA
AGGTCCCAGCAGTGGTGGTCGACCGCACGTTTGTTGTGTATGGCGAAACCAATGTTCTGGCGGCGGAACA
GCGCATTGCCCAGTGGCGTGCTGCTGCCCACCATCAAGATGAAGCTGGCCAGGGAGATATACCGTGA
 Primer design