SecReT4
Protein ID: 28868081
T4SS name [ID]Tfc [761]
Gene symbol-
Locus tagPSPTO_0860
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T4SS(s) in this replicon]
Location [Strand]932028..932483 [-]
Producthypothetical protein
Component typeTfc15
UniProt IDQ889A1
KEGG IDpst:PSPTO_0860
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 151 a.a.     [Download]
>gi|28868081|ref|NP_790700.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MPMPTWIDQLGSARSALMFCLLTAGLLAGCSTNKEQMLPHGQNTMMDVWNQGTTGSAGSASGRQLLDARS
ELRRPIDVRATQPLQDSAAYTRTAQNEIYSQFKRLPNPDLVMYVFPHLAGSDPAPVPGYTTVFPLYQRVQ
YAMPGERVEDY
 
Nucleotide Sequence: 456 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c932483-932028 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGCCAATGCCAACCTGGATTGATCAATTGGGGTCAGCGCGCAGCGCGCTGATGTTTTGCCTTCTCACGG
CGGGCTTGCTGGCTGGATGCTCGACAAACAAAGAGCAAATGCTTCCGCATGGTCAAAACACCATGATGGA
TGTCTGGAACCAAGGGACGACCGGTTCGGCCGGGAGCGCTAGTGGCCGGCAATTGCTCGATGCACGCTCA
GAGTTGCGCCGTCCAATCGATGTACGCGCTACCCAGCCCTTACAGGATAGCGCGGCCTACACCCGTACCG
CTCAAAACGAGATCTACAGTCAGTTCAAGCGCCTGCCCAATCCGGACCTGGTCATGTACGTATTCCCTCA
CCTGGCGGGCTCAGATCCCGCGCCAGTACCGGGGTATACGACTGTTTTTCCGCTGTATCAACGCGTGCAG
TACGCGATGCCCGGTGAGCGGGTGGAGGATTATTGA
 Primer design