SecReT4
Protein ID: 28868083
T4SS name [ID]Tfc [761]
Gene symbol-
Locus tagPSPTO_0862
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T4SS(s) in this replicon]
Location [Strand]933947..934870 [-]
Producthypothetical protein
Component typeTfc13
UniProt IDQ888Z9
KEGG IDpst:PSPTO_0862
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 5.4e-124, Aligned region: 10..305
Protein Sequence: 307 a.a.     [Download]
>gi|28868083|ref|NP_790702.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MRILRVLTGSALLMVLVGTTQIASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPRSLTDKLRVQS
TGGAIYLFAKDAIEPTRLQLQNAKTGEIILVDIAATEAPMDQPALEPVKIVEGETSSARYGGAATARSAK
ATTKSMDSTSRSNDEDDEPEEVVKRETPVPVVLTRYAAQMLYAPLRTVEPVDGIAQVKVERSLDLATLLP
TLPVKSTPLGAWRLDDFWVTAVKLQNQTAQRITLDPRELMGEFVTAAFQHPYLGSQGNASDTTTLYLVTR
GHGLTQATVFSAAPADPRATRGAKHEE
 
Nucleotide Sequence: 924 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c934870-933947 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGAGGATTTTGCGTGTACTCACGGGTTCGGCATTACTGATGGTGTTGGTCGGCACTACACAAATCGCCT
CGGCGGTGGAGATTCTCCGCTGGGAGCGTTTGCCACTGGCCATTCCACTGCGCATCAATCAGGAACGCAT
CGTCTTCGTCGATCAGAATGTCCGAGTCGGGCTTCCGAGGTCTTTGACAGACAAGCTGCGGGTGCAGAGT
ACGGGCGGCGCGATCTACCTGTTTGCCAAGGATGCGATCGAGCCGACACGTCTCCAGCTGCAGAACGCCA
AGACCGGCGAGATCATTCTGGTGGATATCGCTGCTACAGAGGCCCCTATGGATCAACCGGCGCTGGAGCC
GGTGAAGATTGTGGAAGGTGAAACATCATCCGCACGCTATGGAGGGGCTGCTACAGCACGCTCAGCCAAG
GCCACGACAAAGAGCATGGATTCAACCAGCCGGTCGAACGATGAAGACGATGAGCCAGAGGAAGTAGTCA
AGCGAGAAACGCCTGTCCCAGTGGTTCTGACACGCTATGCGGCCCAGATGCTCTATGCGCCGTTGCGCAC
CGTTGAGCCTGTAGACGGCATCGCCCAGGTGAAGGTTGAGCGCAGCCTTGATCTGGCCACCCTGCTTCCC
ACTCTACCTGTGAAGTCCACACCCTTGGGCGCATGGCGTCTGGATGATTTTTGGGTGACAGCCGTGAAGT
TGCAGAATCAGACGGCGCAGCGCATCACGCTCGACCCTCGGGAACTGATGGGTGAGTTCGTGACAGCGGC
CTTTCAACATCCCTATCTCGGGTCGCAAGGTAATGCCAGTGACACTACGACCTTGTACCTGGTCACGCGG
GGACACGGGCTGACACAAGCAACCGTGTTCTCCGCCGCCCCAGCAGATCCGCGTGCAACCCGGGGAGCCA
AGCATGAAGAGTAA
 Primer design