SecReT4
Protein ID: 28868087
T4SS name [ID]Tfc [761]
Gene symbol-
Locus tagPSPTO_0866
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T4SS(s) in this replicon]
Location [Strand]937527..937892 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDQ888Z7
KEGG IDpst:PSPTO_0866
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.5e-34, Aligned region: 11..107
Protein Sequence: 121 a.a.     [Download]
>gi|28868087|ref|NP_790706.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MSELQHDQHEDGTLRFLPSRLNNQPVVIGGLTADEMWVTVFGCSGAGFVMGLPLAFVITPSMPVVCALIG
GTLGLLIAARVLRRLKRGRPETWFYRTLQLRLATLGPTCHRHCKNDPLTPT
 
Nucleotide Sequence: 366 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c937892-937527 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGTCTGAGCTCCAGCACGATCAGCATGAAGACGGCACCTTGCGTTTTCTGCCCAGTCGCTTGAATAACC
AGCCCGTGGTGATTGGTGGTCTTACGGCGGATGAGATGTGGGTGACCGTTTTTGGCTGCAGCGGGGCAGG
CTTTGTGATGGGGCTGCCGTTGGCCTTCGTGATCACTCCATCCATGCCCGTGGTCTGCGCGCTCATCGGA
GGAACATTGGGGCTGCTCATCGCTGCTCGGGTCTTGCGACGTCTCAAACGCGGTCGACCGGAGACCTGGT
TCTACCGCACGTTGCAGTTGCGGCTCGCCACACTCGGCCCTACGTGTCACCGCCACTGTAAAAATGACCC
CCTAACGCCAACCTAG
 Primer design