SecReT4
Protein ID: 28868088
T4SS name [ID]Tfc [761]
Gene symbol-
Locus tagPSPTO_0867
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T4SS(s) in this replicon]
Location [Strand]937908..938276 [-]
Producthypothetical protein
Component typeTfc10
UniProt IDQ888Z6
KEGG IDpst:PSPTO_0867
PDB IDNA
Domain hit(s) vs Pfam DUF2976 [PF11190], Evalue: 8.4e-31, Aligned region: 35..121
Protein Sequence: 122 a.a.     [Download]
>gi|28868088|ref|NP_790707.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MTLLSLFTQARAFLKHRPYPVLLMAATPGSSFAALPGAQAPTRGTGTSFLQTFQNYAFDGFTLLGLCLCA
FGIILVGRHALGVYHEIHMGKAKWADLGSTAVVGVCLIGVTIYLVTTASNIL
 
Nucleotide Sequence: 369 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c938276-937908 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGACGCTGCTTTCATTGTTCACCCAGGCACGTGCCTTTTTGAAACATCGGCCTTATCCGGTCCTGCTGA
TGGCTGCCACCCCCGGTAGTAGTTTTGCAGCGCTACCGGGTGCCCAAGCCCCCACGCGCGGCACAGGAAC
CAGCTTCCTGCAGACATTCCAAAACTACGCTTTCGACGGCTTCACGCTGCTGGGCTTATGCCTGTGCGCG
TTCGGCATCATTCTGGTGGGCCGACATGCGCTGGGCGTCTATCACGAAATCCACATGGGCAAGGCCAAAT
GGGCCGATCTGGGCAGCACCGCAGTGGTCGGCGTCTGCTTGATTGGCGTCACGATCTACCTCGTCACCAC
CGCGTCTAACATCCTTTAA
 Primer design