SecReT4
Protein ID: 28868090
T4SS name [ID]Tfc [761]
Gene symbol-
Locus tagPSPTO_0869
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T4SS(s) in this replicon]
Location [Strand]938532..938897 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDQ888Z4
KEGG IDpst:PSPTO_0869
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 8.1e-29, Aligned region: 35..113
Protein Sequence: 121 a.a.     [Download]
>gi|28868090|ref|NP_790709.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MKINLPALRTTSSRVQICLTAVLLCTPLLFSAHAQAAGTASEQANVEVMIRQLNALEAVAQRSVDLPQDP
AQRYHLDYPRLVSDIARIRQGLQDYLSPSRAQPRDPVELSGHYNVSGDHTP
 
Nucleotide Sequence: 366 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c938897-938532 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
GTGAAAATCAATCTCCCCGCGCTCAGAACAACGTCTTCACGCGTGCAGATCTGCTTGACCGCAGTCCTGC
TGTGCACACCGCTGCTGTTTTCCGCGCATGCCCAGGCAGCCGGCACGGCTTCTGAACAAGCCAATGTGGA
AGTGATGATTCGTCAGCTCAACGCGCTCGAGGCCGTCGCCCAGCGCAGTGTCGATCTTCCACAAGACCCG
GCCCAACGCTATCACCTGGACTATCCCCGGTTGGTCAGCGACATCGCGCGCATCCGCCAGGGCTTGCAAG
ACTACCTGTCGCCGTCCCGCGCACAGCCCCGCGACCCCGTGGAGCTATCAGGCCATTACAACGTCAGCGG
TGATCACACGCCATGA
 Primer design