SecReT4
Protein ID: 28868100
T4SS name [ID]Tfc [761]
Gene symbol-
Locus tagPSPTO_0880
StrainPseudomonas syringae pv. tomato str. DC3000
Repliconchromosome [GenBank: NC_004578] [Browse all T4SS(s) in this replicon]
Location [Strand]951854..952603 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDQ888Y4
KEGG IDpst:PSPTO_0880
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 4.6e-71, Aligned region: 46..246
Protein Sequence: 249 a.a.     [Download]
>gi|28868100|ref|NP_790719.1| unnamed protein product [Pseudomonas syringae pv. tomato str. DC3000]
MADVADRAKQQQDHEQSFIGSLFTLPFRFAAVMFLSLGGAIIVEWICMYFFWPEAGWQHARAMLDHELSW
LSKGFLQSVVVQEPGRTATWLVQTTYDWLVVKTGLQTWVQHTSDYAATGERSRGFDVRYMLGVGVSKFQD
YGLAALYTTLVFCVRLVILTLAIPLFVMTAFVGFVDGLVRRDLRRFGAGRESSYLYHKARATMVPLVIIP
WSLYLALPFSVSPLLVLLPCAALLGLAVSITASSFKKYL
 
Nucleotide Sequence: 750 bp     [Download]
>gi|28867243|ref|NC_004578.1|:c952603-951854 Pseudomonas syringae pv. tomato str. DC3000 chromosome, complete genome
ATGGCTGACGTTGCCGATCGCGCGAAACAGCAACAAGACCACGAACAGTCTTTCATAGGATCTCTCTTCA
CCCTGCCCTTCCGATTCGCGGCAGTAATGTTCCTCTCTCTGGGGGGAGCCATCATCGTCGAATGGATCTG
CATGTACTTCTTCTGGCCGGAGGCCGGTTGGCAGCATGCTCGTGCAATGCTCGATCATGAACTCAGCTGG
CTCTCCAAGGGGTTCCTGCAGAGTGTGGTTGTTCAAGAGCCTGGCCGAACAGCGACATGGCTGGTTCAAA
CCACGTATGACTGGCTGGTGGTCAAGACGGGGCTTCAGACCTGGGTTCAACACACCTCTGATTATGCTGC
GACAGGAGAACGATCACGCGGTTTCGACGTGCGATACATGCTCGGCGTGGGAGTCAGCAAGTTTCAGGAT
TACGGCCTTGCGGCGCTCTACACGACACTGGTGTTTTGCGTGCGTCTGGTGATCCTGACCCTCGCAATCC
CGTTATTTGTGATGACGGCGTTTGTTGGTTTTGTGGACGGACTGGTGCGCAGAGACTTGCGGCGGTTCGG
TGCCGGCCGTGAGTCCAGCTACCTGTATCACAAAGCTCGAGCAACGATGGTGCCGCTGGTGATCATCCCC
TGGAGCCTTTACCTGGCTCTGCCATTCAGCGTGAGCCCTTTGCTAGTGCTCCTGCCATGCGCGGCACTGC
TCGGCCTGGCGGTCAGCATTACGGCGTCCAGCTTCAAAAAATACCTCTAG
 Primer design