SecReT4
Protein ID: 288905846
T4SS name [ID]Ydd [630]
Gene symbol-
Locus tagGALLO_1653
StrainStreptococcus gallolyticus UCN34
Repliconchromosome [GenBank: NC_013798] [Browse all T4SS(s) in this replicon]
Location [Strand]1744118..1746262 [-]
Producthypothetical protein
Component typeYddG
UniProt IDD3HF31
KEGG IDsga:GALLO_1653
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 714 a.a.     [Download]
>gi|288905846|ref|YP_003431068.1| hypothetical protein GALLO_1653 [Streptococcus gallolyticus UCN34]
MNLDTTSILVNLYNKVSGVPIFDLRAYIEPTAKLNLSAVWKILTMIFVNGPFIILDLIVGFISLILRFFE
NFDLYDAYKNTVYDTSKSLWNGLTGSGNYNNSLLYLVIAVTAFTLFVGYVFSKGDIGRRLLHLFAVIMLG
LGYFGTMQNTSGGIYVLDTIHNVANSASATISNMSIVNPENSDNTIDSGISVADNYIARTSYAAYLYVNT
GRLDGKYLNNQTGETEDFDDSKVLGSVIDGEFQEVKPSERDADRKQGGYLDDIGHGADDGEEKNRWVSAV
FDYLFIKCIYVILKIVEAIILGLPLLLIQIMSFVAQLLVIVLMVVFPLALIVSLAPKMQDVIFNVIKLML
GSAFFPVLTGFLTLMVFYIEAVINVFVSDGFTNLEDKLVISFSTFQPLFELVISTAMQGIVFRIIWKNKE
KALSYILGQNQARSLNRIAEGITNMPNQVRESGDNMYERASDMATMGMIATGAGAGLALTAKDGLEKAFS
KFKPDYGEVTPDSADNSDYDDQFEDMGNPSYSDNDSTVEDVDFKEVDPNMADVPLYDEGEPSIEDDSVDY
DGVYQESLPDDSLDDNENVSIEDFEQDLSHEEVIDYHQQADNAQSDKAIEDYSTDNFSKDSAIEEVEVPQ
TESPLTTSDELPNDYRTYRKQAKVDKLEDELSHYQSSDDLGQLEIGQSAFKRGLAKTTTKNRQYRMNKKR
MSAIEQRLAELRGE
 
Nucleotide Sequence: 2145 bp     [Download]
>gi|288904223|ref|NC_013798.1|:c1746262-1744118 Streptococcus gallolyticus UCN34 chromosome, complete genome
ATGAATTTAGATACAACAAGTATTTTAGTGAATCTTTACAATAAAGTATCTGGTGTTCCTATCTTTGATT
TAAGAGCTTATATTGAGCCAACCGCAAAACTTAATTTGAGTGCCGTTTGGAAGATTTTAACAATGATATT
TGTCAATGGTCCATTTATAATTTTAGATTTGATTGTTGGCTTTATTTCGTTAATTCTTCGTTTTTTTGAA
AACTTTGATTTGTATGACGCCTATAAAAATACTGTTTATGACACGTCTAAAAGCTTGTGGAACGGTTTAA
CGGGTTCAGGGAATTATAACAATTCTCTTTTGTATCTTGTGATAGCTGTAACGGCTTTTACTTTGTTTGT
GGGCTATGTTTTTTCTAAAGGGGATATTGGACGTCGATTATTGCATTTGTTTGCGGTGATTATGCTTGGC
TTAGGGTATTTTGGTACTATGCAAAATACATCTGGTGGTATCTATGTCTTGGATACGATTCATAATGTGG
CAAATTCTGCGAGTGCTACGATTTCTAATATGAGCATTGTCAATCCTGAAAATAGTGATAATACAATTGA
TTCGGGAATTTCTGTTGCGGATAATTACATTGCCAGAACTTCTTACGCTGCCTACTTATATGTTAATACA
GGACGTTTAGATGGTAAATACCTTAATAATCAGACAGGTGAAACAGAAGATTTTGATGATTCAAAAGTTC
TTGGTTCTGTAATAGATGGTGAATTTCAAGAAGTAAAGCCAAGCGAACGTGATGCTGATAGAAAGCAAGG
TGGTTATTTAGATGATATAGGACATGGTGCAGATGATGGAGAGGAAAAAAATCGCTGGGTTTCAGCGGTT
TTTGACTATCTTTTCATTAAGTGTATTTATGTCATTTTAAAAATTGTTGAAGCGATTATTTTAGGACTGC
CGTTGCTTTTGATTCAAATAATGTCTTTTGTGGCACAACTTTTAGTGATAGTCTTAATGGTTGTTTTTCC
ATTGGCTTTAATTGTATCGTTAGCTCCAAAAATGCAAGATGTGATTTTTAACGTGATTAAATTGATGTTG
GGGTCAGCATTTTTCCCTGTGTTAACAGGCTTCTTAACGTTGATGGTCTTTTATATTGAAGCAGTTATCA
ATGTCTTTGTTTCAGACGGTTTTACTAATTTAGAGGATAAATTAGTAATTAGTTTTAGCACGTTTCAACC
TCTTTTTGAACTTGTGATTTCAACAGCTATGCAAGGTATTGTTTTTAGGATTATTTGGAAGAATAAAGAA
AAAGCGTTGAGTTATATCTTAGGTCAAAATCAGGCAAGGAGTTTAAACCGAATTGCCGAGGGAATAACCA
ATATGCCTAATCAAGTTCGTGAATCAGGTGATAATATGTATGAACGAGCGAGTGATATGGCGACAATGGG
AATGATTGCAACTGGTGCAGGTGCAGGGTTAGCCTTAACAGCTAAAGATGGTCTGGAAAAAGCTTTTTCA
AAATTTAAACCAGATTATGGTGAGGTAACACCTGATTCAGCGGATAATTCTGATTATGATGACCAATTTG
AGGATATGGGTAATCCGTCATATAGTGATAATGATTCTACTGTTGAAGATGTTGACTTTAAAGAAGTTGA
CCCTAACATGGCAGATGTTCCACTATATGATGAGGGTGAACCAAGTATTGAAGATGACAGCGTTGATTAT
GATGGTGTTTATCAAGAAAGCTTACCTGATGATTCTCTTGATGATAATGAAAATGTTTCTATTGAAGATT
TTGAACAAGATTTGTCACATGAAGAAGTCATTGACTATCATCAACAAGCAGATAATGCTCAAAGTGATAA
AGCTATTGAAGATTATTCAACGGATAACTTTTCAAAAGATTCAGCGATTGAAGAGGTAGAAGTTCCTCAA
ACAGAATCTCCTTTAACAACGTCTGATGAGTTACCGAATGATTATCGAACGTATCGTAAACAAGCTAAGG
TTGATAAATTGGAAGATGAATTATCCCACTATCAATCTAGTGATGATTTAGGACAGTTAGAAATAGGTCA
ATCAGCTTTTAAACGTGGATTAGCTAAAACAACGACTAAAAATAGACAATATCGTATGAATAAAAAACGA
ATGTCAGCTATTGAACAACGATTAGCAGAATTGCGAGGTGAATAA
 Primer design