SecReT4
Protein ID: 288905847
T4SS name [ID]Ydd [630]
Gene symbol-
Locus tagGALLO_1654
StrainStreptococcus gallolyticus UCN34
Repliconchromosome [GenBank: NC_013798] [Browse all T4SS(s) in this replicon]
Location [Strand]1746272..1748773 [-]
Productconjugative transposon protein
Component typeYddE
UniProt IDD3HF32
KEGG IDsga:GALLO_1654
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.6e-25, Aligned region: 464..762
DUF87 [PF01935], Evalue: 3.5e-06, Aligned region: 465..593
FtsK_SpoIIIE [PF01580], Evalue: 3.9e-05, Aligned region: 460..510
Protein Sequence: 833 a.a.     [Download]
>gi|288905847|ref|YP_003431069.1| conjugative transposon protein [Streptococcus gallolyticus UCN34]
MVKRLEYPIAKTDGNMALRKDGVVTAFYRVPNTPITITDTDKKKKHKITVSQVVKKLAKYKYFEVSLIPR
DYLLEEKMRDFSDDLADDSKVLGEQTLSKTVGLLTKEMEIPYEYEWIVGINIEKTIVKNNLTEAVTNQLS
EIAENIAGFLGFEVETLENWYEDYQEIESIIYRLLSPLKAKRLTNEELFYYQRYQFLTYIPHLREDVIAN
RALENVTDTVITVVEEGILKLSSIYGTSYLSILPIGRYSTIFNGFHLGELLQRLSFPVWLKMKAEFIDKS
GLNGQMGRSNNRYRNIMNEAASTDTVQQDDILMGAYSLKDLMKKVGNKEELIRFGAYVTVAASNIKQLKQ
RRQSLLSYFQDMSVSLHEAGHDTPYLFQSLLYGQDLQVTTRKWNHLVTCKGFAELMLFTNTRSGNRIGWY
IGRVDNRLTAWDNIDEAVQGSKNLVLFNATVANKEDIAGKVTKNPHLIITGATGNGKSYLAQLLFLLTSQ
QNVRILYIDPKRELREHYQKVISQPDFARRFPERKKQIENINFVTLDATLESNHGVLDPIVILEKENAQA
TAKNMLLYLLRQATQVELTQTTSLTNAITTVLERREAGETVGFNHVIELLCQDVDKKVVEVGEYFKAIIR
NSILELAFSDGNVKGLSYDERVTVLEIADLSLPKDGVEDISDHEANSICLMFALGAFCKHFGERNDDETL
EIFDEAWILMQSSEGKAVIKSMRRVGRSKYNTLCLVTQSVHDAENEEDSTGFGTIFAFYEKSERKDILKH
VGLEVTEKNLEWLDNMISGQCLYYDVYGNLNMISVHNLFEDIDPFLKPMKQTTSSVLENKYAS
 
Nucleotide Sequence: 2502 bp     [Download]
>gi|288904223|ref|NC_013798.1|:c1748773-1746272 Streptococcus gallolyticus UCN34 chromosome, complete genome
ATGGTAAAGCGTTTGGAATATCCGATAGCAAAGACTGATGGAAATATGGCTTTACGTAAGGACGGTGTTG
TCACGGCTTTTTATCGAGTTCCGAACACACCAATTACAATTACAGATACGGATAAAAAGAAAAAACATAA
GATAACAGTTTCACAGGTGGTTAAGAAGCTAGCAAAATATAAATATTTTGAAGTTTCTTTGATTCCCAGG
GACTATCTATTAGAAGAAAAAATGCGAGATTTTTCAGATGATTTAGCTGATGATTCAAAAGTATTAGGTG
AACAAACACTTAGTAAAACTGTTGGACTATTGACTAAAGAGATGGAAATTCCTTATGAGTATGAATGGAT
AGTCGGTATTAATATTGAAAAAACGATAGTTAAAAATAATTTAACTGAAGCTGTTACGAATCAATTATCA
GAAATAGCGGAAAATATTGCTGGCTTTTTAGGTTTTGAAGTTGAGACCTTAGAGAATTGGTATGAAGATT
ATCAAGAGATTGAATCCATTATCTATCGCCTACTATCACCGTTAAAAGCAAAACGATTAACAAATGAAGA
ATTGTTCTATTATCAACGGTATCAGTTCTTAACTTATATTCCTCATTTGAGGGAAGATGTGATTGCCAAT
CGTGCTTTGGAAAATGTGACAGATACTGTGATTACCGTTGTTGAAGAGGGAATTTTAAAACTATCTAGTA
TTTACGGTACTTCTTACCTTTCTATTTTGCCAATTGGTCGGTATTCAACGATTTTTAATGGTTTTCATTT
AGGTGAGTTGCTTCAACGATTAAGTTTTCCTGTTTGGTTGAAAATGAAAGCAGAGTTTATTGATAAGTCT
GGTTTAAACGGTCAAATGGGGCGGTCGAATAATCGTTATCGTAACATTATGAATGAAGCGGCTAGTACGG
ATACGGTACAGCAAGATGATATTTTAATGGGTGCTTATTCGTTGAAAGATTTAATGAAAAAAGTTGGTAA
CAAGGAAGAATTGATACGTTTTGGAGCGTATGTGACGGTGGCTGCTTCAAACATTAAACAGTTGAAACAA
CGTCGTCAATCGTTACTTTCTTACTTCCAAGATATGAGTGTTAGTTTGCATGAGGCAGGTCATGATACGC
CTTATCTTTTCCAAAGTTTGCTTTACGGTCAAGATTTGCAAGTTACTACTCGCAAATGGAATCATTTAGT
TACTTGTAAAGGCTTTGCGGAGTTAATGTTGTTTACAAATACACGTTCAGGTAACCGTATTGGTTGGTAT
ATTGGACGAGTAGATAATCGGCTGACTGCTTGGGATAATATTGATGAAGCGGTTCAAGGTTCTAAGAACT
TAGTTCTCTTTAATGCGACCGTCGCAAATAAAGAGGATATTGCTGGTAAAGTAACGAAAAACCCACACTT
GATTATCACAGGTGCAACAGGTAATGGGAAGTCCTATCTTGCCCAATTACTTTTCTTGTTGACAAGCCAA
CAAAATGTGAGAATTTTGTACATTGACCCAAAACGTGAACTCCGTGAGCATTATCAAAAGGTGATTAGTC
AACCTGATTTTGCAAGACGTTTTCCAGAACGTAAAAAACAAATTGAGAATATCAATTTTGTGACCCTTGA
CGCTACCCTTGAATCGAATCATGGGGTACTTGACCCAATTGTGATTTTGGAAAAAGAAAATGCGCAAGCA
ACAGCTAAAAATATGTTGCTTTACTTGTTACGTCAAGCGACACAGGTTGAACTCACTCAAACAACGTCGT
TGACAAATGCGATTACAACGGTTTTAGAACGACGTGAAGCTGGCGAAACAGTTGGCTTTAATCATGTGAT
TGAGCTACTTTGTCAAGACGTTGATAAAAAGGTTGTTGAAGTTGGTGAGTATTTTAAAGCCATTATTCGT
AATTCAATCTTAGAGTTAGCCTTTTCAGACGGTAATGTTAAAGGGCTTTCTTATGATGAACGGGTAACTG
TTTTAGAGATTGCGGATTTGTCATTGCCAAAAGATGGTGTGGAAGATATTTCAGACCATGAAGCAAATTC
AATTTGCTTGATGTTTGCACTAGGTGCATTTTGTAAACATTTTGGTGAACGTAATGATGATGAAACACTT
GAAATTTTTGATGAAGCATGGATTTTAATGCAATCATCAGAGGGAAAAGCGGTTATCAAGTCTATGCGCC
GTGTCGGACGGTCTAAATATAACACGCTTTGCTTGGTTACTCAATCTGTTCATGACGCTGAAAATGAAGA
AGATTCTACTGGTTTTGGAACAATCTTTGCCTTTTACGAAAAATCGGAACGAAAAGATATTCTGAAACAT
GTAGGCTTAGAAGTGACTGAAAAAAATCTAGAATGGCTGGATAATATGATTTCAGGACAATGTCTTTATT
ATGATGTTTATGGCAACTTGAACATGATTTCAGTCCATAATTTGTTTGAAGATATTGATCCATTCTTAAA
ACCAATGAAACAAACAACGTCAAGTGTACTAGAAAATAAATACGCTAGTTAG
 Primer design