SecReT4
Protein ID: 288905850
T4SS name [ID]Ydd [630]
Gene symbol-
Locus tagGALLO_1657
StrainStreptococcus gallolyticus UCN34
Repliconchromosome [GenBank: NC_013798] [Browse all T4SS(s) in this replicon]
Location [Strand]1749757..1750167 [-]
Producthypothetical protein
Component typeYddD
UniProt IDD3HF35
KEGG IDsga:GALLO_1657
PDB IDNA
Domain hit(s) vs Pfam TcpE [PF12648], Evalue: 1.3e-25, Aligned region: 8..119
Protein Sequence: 136 a.a.     [Download]
>gi|288905850|ref|YP_003431072.1| hypothetical protein GALLO_1657 [Streptococcus gallolyticus UCN34]
MEEEQLFDYSRGINAPYWIQEIKSPKGKRIWYFSTPMQVSFFVVLFLVLFLMLQFLSPLMSWLISHTHSI
AILLYAVVPYKIAKYYTETEPEGKKMHIFIMDWLKYWFEFSLDKRAIYQGERVETETEFVFEKTHL
 
Nucleotide Sequence: 411 bp     [Download]
>gi|288904223|ref|NC_013798.1|:c1750167-1749757 Streptococcus gallolyticus UCN34 chromosome, complete genome
ATGGAAGAAGAACAATTGTTTGATTATAGTAGGGGTATTAATGCTCCCTACTGGATACAGGAAATTAAGT
CACCTAAAGGAAAGCGTATTTGGTATTTTTCAACGCCAATGCAAGTTTCCTTTTTTGTTGTTTTGTTTTT
AGTGTTGTTTTTAATGCTTCAATTCTTATCACCTTTGATGTCGTGGTTAATTTCTCATACGCATTCAATT
GCCATTTTGCTTTATGCTGTTGTGCCGTATAAAATCGCAAAATATTATACGGAGACAGAACCAGAGGGTA
AAAAAATGCATATTTTCATTATGGATTGGTTGAAATATTGGTTTGAGTTTAGCTTAGATAAGCGAGCCAT
TTATCAAGGCGAGCGAGTTGAGACAGAAACAGAATTTGTTTTTGAGAAAACTCATTTGTAA
 Primer design