SecReT4
Protein ID: 288905852
T4SS name [ID]Ydd [630]
Gene symbol-
Locus tagGALLO_1659
StrainStreptococcus gallolyticus UCN34
Repliconchromosome [GenBank: NC_013798] [Browse all T4SS(s) in this replicon]
Location [Strand]1750473..1751447 [-]
Producthypothetical protein
Component typeYddB
UniProt IDD3HF37
KEGG IDsga:GALLO_1659
PDB IDNA
Domain hit(s) vs Pfam TpcC [PF12642], Evalue: 1.3e-41, Aligned region: 98..317
Protein Sequence: 324 a.a.     [Download]
>gi|288905852|ref|YP_003431074.1| hypothetical protein GALLO_1659 [Streptococcus gallolyticus UCN34]
MKLKGGVITQIKAFLMKFSKKEKQGKQPKVKELSKRSANIMTYGFLLFFVFIGFIGLVRAISLSSQVNSL
KNKVADFETTLTDSANQTSTLDVSRVQYYMTNFIYAYINYDKESAEEREQTLQDYYAFDSSGYTEELNET
RTLKSQRVISVEEYRSYDLAIVKVGYEVSGNSYVMNLAVPFKIKDGLLTIVSLPYSLADNLYQGDSKSFE
KNDSSDLVKLSSSETDSIKDFLEVFFDKYASSDETDLKLVMKEPVLMGGSYQVDTIDDSTALFYEGDDGQ
KVVQVSVTFTDKNTTDKHTENFTLYLSQSDNGWVVEKLYNYFKN
 
Nucleotide Sequence: 975 bp     [Download]
>gi|288904223|ref|NC_013798.1|:c1751447-1750473 Streptococcus gallolyticus UCN34 chromosome, complete genome
TTGAAATTAAAAGGGGGTGTTATCACCCAGATTAAAGCATTTTTAATGAAATTTTCAAAAAAAGAAAAAC
AAGGCAAACAACCAAAGGTTAAGGAGCTATCTAAAAGGAGTGCTAATATCATGACTTATGGTTTTTTGCT
TTTCTTTGTGTTTATTGGTTTTATTGGTTTAGTAAGAGCAATCTCATTATCTAGTCAAGTAAATTCATTG
AAAAATAAGGTGGCTGATTTTGAAACAACCTTAACGGATAGTGCTAATCAGACCTCGACGTTAGATGTGT
CACGTGTTCAATACTACATGACTAATTTCATCTATGCGTATATTAATTATGATAAAGAATCTGCGGAGGA
GCGGGAACAGACTTTGCAAGATTATTACGCTTTTGATTCTTCAGGTTATACGGAAGAATTGAATGAGACA
CGAACGTTAAAATCACAACGTGTGATTAGTGTTGAGGAATATAGGTCTTATGATTTAGCAATTGTAAAAG
TTGGTTATGAAGTTAGTGGCAACAGTTATGTCATGAACTTAGCTGTTCCTTTTAAGATTAAAGATGGCTT
GCTGACAATTGTTAGCCTACCTTATAGCTTGGCTGACAACCTTTATCAAGGTGATTCTAAATCATTTGAG
AAGAATGATTCGTCTGATTTGGTGAAGTTATCATCTAGTGAAACAGATTCGATTAAAGACTTTTTGGAAG
TATTCTTTGATAAATACGCTTCAAGTGATGAGACGGATTTAAAATTGGTGATGAAAGAACCAGTCTTAAT
GGGTGGTTCGTATCAAGTGGATACGATTGATGATTCAACGGCTCTCTTTTATGAGGGTGATGATGGTCAA
AAGGTTGTGCAAGTGTCTGTCACATTTACAGATAAAAATACAACTGATAAACATACTGAAAATTTCACTT
TGTATTTGTCACAATCAGATAATGGTTGGGTTGTTGAAAAGTTATATAACTATTTTAAAAATTAA
 Primer design