SecReT4
Protein ID: 288905865
T4SS name [ID]Ydd [630]
Gene symbol-
Locus tagGALLO_1672
StrainStreptococcus gallolyticus UCN34
Repliconchromosome [GenBank: NC_013798] [Browse all T4SS(s) in this replicon]
Location [Strand]1757031..1758740 [-]
ProductDNA segregation ATPase FtsK
Component typeYdcQ
UniProt IDD3HF50
KEGG IDsga:GALLO_1672
PDB IDNA
Domain hit(s) vs Pfam FtsK_SpoIIIE [PF01580], Evalue: 4.6e-21, Aligned region: 182..357
DUF853 [PF05872], Evalue: 2.6e-05, Aligned region: 209..268
Protein Sequence: 569 a.a.     [Download]
>gi|288905865|ref|YP_003431087.1| DNA segregation ATPase FtsK [Streptococcus gallolyticus UCN34]
MRLLPEYRGRRIRPYMRKLNVTLAFVFSFVLLLPSIAFGYVNIDALKAVDVKTIVILAVLSVLAIVLGIW
FSWFFREQTPFGKKVDRLGILSKYFFEHGFYYEKKRSGQNVKSKIRYPKIYVKQRKYDLDISFEMAGNKF
QDKFSKMGGELEKTLFMDFMETVDDVKYKTYTMAYQAFLNRINVTDVTYEKGKGLLLMKNFYWDFDSDPH
LLVAGGTGGGKTVLLQTLVLALAKIGVVDICDPKQADFVAIADMPAFKGRVAFDVEDIIQRFEKAEVIMM
ARYKFMNDERVRLKHKSLKKYYEYGLEPYFISCDELNALMAMLDYKQRERLDKSLGNILFLGRQAGVFDI
SAMQKPSREDLGSKLQANINMRLNVGRLDDGGYDIMYGEVNRNKDFKYLKYISGRRVYGRGYGAVMGDVA
REFFSPNMPKGFEFYDEFIKLERHENRFDPDENPEISVDIVNDKELLAVATEATNQANQISANKVQTEET
KYSLKEVADSIGASRPQVFKVVKMIEDDGYTTFEHDDTDKQVLTSSEVALVKELFDFKATNDLTWSNAVE
QYFTKESED
 
Nucleotide Sequence: 1710 bp     [Download]
>gi|288904223|ref|NC_013798.1|:c1758740-1757031 Streptococcus gallolyticus UCN34 chromosome, complete genome
ATGCGATTATTGCCTGAATATAGAGGGCGACGAATTCGTCCGTACATGCGAAAGCTAAATGTGACTTTAG
CTTTCGTTTTTTCTTTTGTGTTGTTGTTACCATCAATTGCTTTTGGTTATGTTAATATTGACGCTTTAAA
AGCAGTAGATGTTAAAACAATTGTGATTTTAGCTGTTTTAAGTGTTTTGGCAATTGTTTTAGGTATTTGG
TTTTCATGGTTTTTTAGAGAACAAACGCCTTTTGGTAAGAAAGTTGACCGTTTAGGTATTTTATCAAAAT
ATTTTTTTGAACATGGTTTTTATTATGAGAAAAAGCGGTCAGGTCAAAATGTAAAGTCTAAAATTAGGTA
TCCAAAAATTTATGTGAAACAGCGTAAATATGATTTGGATATTTCGTTTGAGATGGCTGGGAACAAATTT
CAAGATAAGTTTTCAAAAATGGGTGGTGAGCTTGAAAAAACGTTGTTTATGGATTTTATGGAAACAGTAG
ATGACGTTAAATATAAGACGTATACTATGGCTTATCAAGCTTTTCTTAATCGTATTAATGTTACAGATGT
AACGTACGAAAAAGGAAAAGGCTTGTTGCTGATGAAAAATTTTTATTGGGATTTTGATTCAGACCCACAT
TTGCTTGTTGCAGGTGGTACTGGTGGTGGTAAAACGGTTCTTTTGCAAACATTAGTTTTAGCTTTAGCTA
AAATTGGTGTGGTTGATATTTGTGACCCTAAGCAGGCTGATTTTGTAGCGATAGCTGATATGCCAGCTTT
TAAAGGTCGTGTTGCTTTTGATGTTGAAGATATTATACAACGTTTTGAGAAAGCAGAAGTAATCATGATG
GCACGTTATAAATTCATGAATGATGAACGTGTTCGATTGAAACATAAGAGTTTAAAAAAATATTATGAAT
ATGGCTTAGAGCCGTATTTTATTAGTTGTGATGAGCTTAACGCTTTAATGGCAATGTTAGATTATAAACA
ACGTGAACGATTAGATAAATCACTTGGAAACATTTTGTTTTTAGGTCGTCAAGCGGGTGTTTTTGATATT
TCTGCTATGCAAAAACCAAGTCGTGAAGATTTGGGTTCTAAATTGCAAGCAAATATTAATATGCGTTTGA
ACGTTGGGCGTCTTGATGATGGAGGCTATGACATTATGTATGGTGAAGTTAATCGTAACAAAGATTTTAA
ATATCTTAAATATATTTCTGGTCGTCGTGTCTATGGTCGTGGATATGGTGCTGTTATGGGTGATGTGGCT
CGTGAGTTTTTCTCACCGAATATGCCTAAAGGATTTGAGTTTTATGATGAGTTTATTAAATTAGAGCGTC
ATGAAAATCGTTTTGACCCTGATGAAAATCCAGAAATTTCTGTTGATATTGTTAACGATAAAGAACTTTT
GGCGGTTGCCACAGAAGCGACTAATCAGGCTAATCAGATATCGGCTAACAAAGTTCAAACAGAAGAGACT
AAATATAGCTTAAAAGAAGTTGCTGATAGTATTGGTGCTTCTCGTCCACAAGTTTTTAAGGTTGTGAAAA
TGATTGAAGATGACGGTTATACAACTTTTGAGCATGATGATACTGATAAACAGGTATTAACTAGTTCAGA
AGTGGCTTTAGTGAAAGAGCTCTTTGACTTTAAAGCAACAAATGATTTAACGTGGTCTAATGCTGTGGAG
CAGTATTTTACCAAAGAAAGTGAAGATTAG
 Primer design