SecReT4
Protein ID: 288905883
T4SS name [ID]Tra_Tn [652]
Gene symbol-
Locus tagGALLO_1690
StrainStreptococcus gallolyticus UCN34
Repliconchromosome [GenBank: NC_013798] [Browse all T4SS(s) in this replicon]
Location [Strand]1775580..1776581 [-]
Producthypothetical protein
Component typeOrf14_Tn
UniProt IDD3HF68
KEGG IDsga:GALLO_1690
PDB IDNA
Domain hit(s) vs Pfam Lysozyme_like [PF13702], Evalue: 8.1e-61, Aligned region: 46..202
NLPC_P60 [PF00877], Evalue: 1.2e-31, Aligned region: 224..329
Protein Sequence: 333 a.a.     [Download]
>gi|288905883|ref|YP_003431105.1| hypothetical protein GALLO_1690 [Streptococcus gallolyticus UCN34]
MKLKALVIGGSGLFLMVFSLLLFVAILFSDEQDSGISNIHYGGVNVSAEVLAHKPMVEKYAKEYGVEEYV
NILLAIIQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGVKYFSELLASSERLSVDLESVIQSYNYGG
GFLGYVANRGNKYTFELAQSFSKEYSGGEKVSYPNPIAIPINGGWRYNYGNMFYVQLVTQYLVTTEFDDD
TVQAIMDEALKYEGWRYVYGGASPTTSFDCSGLTQWTYGKAGINLPRTAQQQYDVTQHIPLSEAQAGDLV
FFHSTYNAGSYITHVGIYLGNNRMFHAGDPIGYADLTSPYWQQHLVGAGRIKQ
 
Nucleotide Sequence: 1002 bp     [Download]
>gi|288904223|ref|NC_013798.1|:c1776581-1775580 Streptococcus gallolyticus UCN34 chromosome, complete genome
ATGAAACTGAAAGCTTTAGTGATTGGTGGTTCTGGGCTATTCTTGATGGTCTTCTCACTGCTTCTGTTTG
TTGCCATTTTATTTTCAGATGAACAGGACAGCGGAATTTCCAATATTCATTATGGAGGTGTGAATGTTTC
CGCAGAAGTGCTGGCTCATAAGCCTATGGTAGAAAAATATGCCAAAGAATATGGCGTTGAAGAATATGTC
AACATACTTCTTGCGATTATACAGGTGGAATCGGGCGGTACTGCGGAAGATGTTATGCAGTCCTCGGAAT
CCCTCGGTCTTCCACCTAATTCATTGAGTACAGAAGAATCCATTAAGCAAGGTGTGAAGTATTTCAGTGA
ATTATTAGCCAGTAGCGAAAGGCTCAGTGTAGATTTAGAATCGGTTATCCAGTCCTACAATTATGGTGGT
GGTTTCTTAGGGTATGTGGCTAATCGTGGAAATAAATATACCTTTGAACTGGCTCAAAGTTTCTCAAAAG
AGTATTCAGGTGGCGAAAAAGTGTCTTACCCCAATCCCATAGCCATACCTATCAATGGGGGCTGGCGATA
CAACTATGGCAATATGTTTTATGTGCAACTGGTAACGCAGTATCTTGTCACAACAGAGTTTGATGATGAT
ACGGTACAAGCCATCATGGACGAAGCACTGAAATATGAGGGCTGGCGATACGTTTACGGTGGAGCTTCCC
CGACTACTTCTTTTGATTGTAGCGGACTGACACAATGGACGTATGGAAAAGCTGGAATTAACTTACCACG
AACCGCACAACAGCAATATGATGTGACCCAGCATATCCCACTATCGGAAGCACAAGCTGGCGATTTGGTT
TTCTTTCATTCTACCTATAACGCTGGCTCTTATATTACTCATGTTGGGATATACCTTGGCAATAACCGTA
TGTTTCATGCAGGCGACCCAATCGGTTATGCCGACTTAACAAGCCCCTACTGGCAACAGCATTTAGTGGG
AGCAGGACGAATCAAACAATGA
 Primer design