SecReT4
Protein ID: 289163711
T4SS name [ID]Dot/Icm [44]
Gene symboldotB
Locus tagLLO_0367
StrainLegionella longbeachae NSW150
Repliconchromosome [GenBank: NC_013861] [Browse all T4SS(s) in this replicon]
Location [Strand]410780..411910 [-]
Productdefect in organelle trafficking protein DotB (ATPase)
Component typeDotB
UniProt IDD3HP82
KEGG IDllo:LLO_0367
PDB IDNA
Domain hit(s) vs Pfam T2SE [PF00437], Evalue: 1.4e-30, Aligned region: 138..271
AAA_29 [PF13555], Evalue: 2.5e-05, Aligned region: 146..170
AAA_19 [PF13245], Evalue: 3.7e-05, Aligned region: 140..183
AAA_16 [PF13191], Evalue: 3.9e-05, Aligned region: 139..188
AAA_23 [PF13476], Evalue: 5.4e-05, Aligned region: 146..168
AAA_14 [PF13173], Evalue: 0.0001, Aligned region: 148..277
Protein Sequence: 376 a.a.     [Download]
>gi|289163711|ref|YP_003453849.1| defect in organelle trafficking protein DotB (ATPase) [Legionella longbeachae NSW150]
MSNNIHLMPDEPTRFTPLFMDRMLEHTERLNASDITIQTGEPIYAEVYGKLFRITNRRLSNTELGDLINA
IYGPNATTQLLSGKDIDTHYEFRPNRGVRYRYRVNGTACLVEGHDAIQITLRTIPTTPPRLESMHLPEDV
LEAIAPQEGIVFITGATGSGKSTLLASIIRQLIEFEDSHRKVLTYESPIEFVYDEIETISAVVSQSEIPR
HLPSFADGVRNALRRKPRLIMVGECRDAETISAALEAALTGHPVYTTLHTSGVAETMRRLVTSFSGEERL
GRTIDILETIRLCIWQKLVPTVDDKRVALREYLVFDEEVRDILLEGDPNDVTSATRKLVRQKGQLMTWDA
KAKFEQGIISERVYKLIIAGAKEYQQ
 
Nucleotide Sequence: 1131 bp     [Download]
>gi|289163353|ref|NC_013861.1|:c411910-410780 Legionella longbeachae NSW150 chromosome, complete genome
ATGAGTAACAATATTCATTTAATGCCTGATGAGCCTACTCGTTTTACTCCATTGTTCATGGACAGAATGC
TGGAGCATACTGAACGACTAAATGCCTCGGACATTACTATTCAAACTGGCGAACCTATATATGCGGAAGT
TTATGGTAAATTGTTCCGCATTACTAATCGGCGTTTATCAAACACGGAGCTTGGCGATTTAATTAATGCC
ATTTATGGGCCTAATGCGACGACCCAGCTTCTTTCAGGTAAAGACATAGATACACACTATGAATTTCGCC
CTAATCGAGGTGTTAGATATCGTTATCGGGTGAATGGCACAGCCTGTCTGGTAGAGGGACATGATGCAAT
CCAAATCACTTTAAGAACGATTCCCACAACGCCTCCACGGTTGGAATCGATGCACCTTCCAGAGGATGTT
CTAGAGGCCATTGCACCTCAAGAAGGAATTGTATTTATTACCGGAGCAACAGGTTCAGGTAAATCAACTT
TATTAGCTTCAATTATTCGACAGCTCATCGAATTTGAAGATTCTCATCGTAAAGTATTAACTTATGAGTC
ACCTATTGAGTTCGTTTATGATGAAATTGAAACAATATCGGCCGTTGTAAGCCAATCAGAAATCCCAAGA
CACTTACCCAGTTTTGCGGATGGTGTACGAAATGCATTACGCAGGAAGCCCCGCTTAATCATGGTAGGGG
AGTGTAGAGATGCAGAAACGATCAGCGCAGCCTTAGAAGCGGCTCTAACTGGACATCCTGTGTATACAAC
TTTGCATACTTCAGGAGTTGCAGAAACCATGCGTCGACTCGTTACCTCATTCTCTGGTGAAGAGCGTCTT
GGTAGAACGATCGACATCTTAGAAACAATAAGATTATGTATATGGCAAAAATTAGTGCCCACTGTAGATG
ACAAGAGAGTTGCCTTAAGAGAGTATTTAGTATTTGACGAAGAGGTTCGAGATATTTTACTTGAAGGTGA
TCCTAACGATGTCACATCCGCCACACGTAAGCTAGTTCGTCAAAAAGGCCAGCTCATGACTTGGGATGCC
AAAGCAAAATTCGAACAAGGTATTATCAGTGAGCGAGTATATAAATTAATCATTGCTGGTGCAAAAGAAT
ACCAACAATAG
 Primer design