SecReT4
Protein ID: 289165174
T4SS name [ID]Tra_F [531]
Gene symbol-
Locus tagLLO_1837
StrainLegionella longbeachae NSW150
Repliconchromosome [GenBank: NC_013861] [Browse all T4SS(s) in this replicon]
Location [Strand]2168775..2169521 [-]
Productconjugative transfer protein TraF
Component typeTraF_F
UniProt IDD3HTH3
KEGG IDllo:LLO_1837
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 9.2e-68, Aligned region: 24..238
Protein Sequence: 248 a.a.     [Download]
>gi|289165174|ref|YP_003455312.1| conjugative transfer protein TraF [Legionella longbeachae NSW150]
MIKWSVVLLIVLHSLTVLAEKPVGFLWYSIEKELHPIKKTPPRGTPFNQLSYTQQDAVLHFYTMEALHKA
RQTKKVEDMRVFLSLQDYWLKESSRFKQLFQKTMLAYPQYDYTVTHPTSNLGAKITDEVRERKKEEVIHH
AVKSHGLLFFYRGKSPYDQKQIPILVDFCRRFNLSMMPVSIDGVVLPELPNSRIDQGQAERLGVRYFPAL
LLVKPENQQVNPIAYGLTTQDVLMERIVQVTTQFQGEL
 
Nucleotide Sequence: 747 bp     [Download]
>gi|289163353|ref|NC_013861.1|:c2169521-2168775 Legionella longbeachae NSW150 chromosome, complete genome
ATGATTAAATGGAGTGTTGTTTTGTTAATCGTCCTTCATTCACTGACCGTACTTGCTGAAAAACCGGTAG
GCTTTCTTTGGTACAGCATCGAAAAGGAACTCCATCCAATAAAAAAAACACCTCCTCGCGGCACACCGTT
TAACCAGCTTAGTTATACACAGCAAGATGCCGTACTTCATTTTTACACCATGGAAGCGTTGCACAAAGCA
CGCCAAACCAAAAAGGTGGAGGACATGCGTGTTTTTTTAAGCCTTCAAGATTACTGGCTTAAAGAGTCAT
CCCGTTTTAAGCAACTGTTTCAAAAAACAATGCTTGCTTATCCTCAGTATGATTATACAGTCACTCATCC
TACTTCCAATCTTGGGGCCAAAATAACCGATGAAGTTCGTGAACGAAAAAAAGAAGAAGTGATTCATCAT
GCAGTAAAATCCCATGGCTTATTGTTTTTTTACCGCGGTAAAAGTCCCTATGACCAAAAGCAAATACCTA
TCCTTGTTGATTTTTGCAGGCGTTTTAATCTTTCGATGATGCCTGTGAGTATCGATGGCGTAGTTCTGCC
AGAACTTCCGAACTCACGAATCGACCAGGGGCAAGCAGAGCGTTTGGGGGTTCGTTATTTTCCAGCGCTT
CTTTTGGTCAAACCCGAAAACCAACAAGTAAACCCTATCGCTTATGGATTGACCACTCAAGATGTATTAA
TGGAGCGCATCGTTCAAGTGACCACCCAATTTCAAGGAGAGCTCTAA
 Primer design