SecReT4
Protein ID: 289165185
T4SS name [ID]Tra_F [531]
Gene symboltraL
Locus tagLLO_1848
StrainLegionella longbeachae NSW150
Repliconchromosome [GenBank: NC_013861] [Browse all T4SS(s) in this replicon]
Location [Strand]2179100..2179396 [-]
ProductType IV conjugative transfer system protein TraL, proteobacteria
Component typeTraL_F
UniProt IDD3HTI4
KEGG IDllo:LLO_1848
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 2.8e-26, Aligned region: 6..97
Protein Sequence: 98 a.a.     [Download]
>gi|289165185|ref|YP_003455323.1| Type IV conjugative transfer system protein TraL, proteobacteria [Legionella longbeachae NSW150]
MSNIAYQFLNHIDAPKRILTLTGDELFVAVLGFMLLVIANQKILVSLFGLGLLSGLRFLKKGEGPKSLLV
LAYWYLPSSLTQFFLPKLPPSHHRIYVA
 
Nucleotide Sequence: 297 bp     [Download]
>gi|289163353|ref|NC_013861.1|:c2179396-2179100 Legionella longbeachae NSW150 chromosome, complete genome
ATGAGCAACATAGCGTATCAGTTTTTAAACCACATAGATGCACCAAAGCGGATACTGACCTTAACCGGAG
ATGAGCTCTTTGTTGCAGTATTAGGGTTTATGTTGCTCGTTATTGCTAACCAAAAAATATTGGTGTCGTT
ATTCGGGCTGGGATTATTAAGCGGTTTGCGTTTCTTGAAAAAAGGAGAAGGGCCAAAATCATTGCTGGTT
CTTGCTTATTGGTATTTGCCAAGCAGCCTGACGCAGTTCTTTTTACCCAAACTCCCACCATCTCACCATC
GAATTTATGTCGCTTAA
 Primer design