SecReT4
Protein ID: 289166207
T4SS name [ID]Trb [55]
Gene symbol-
Locus tagLLO_2877
StrainLegionella longbeachae NSW150
Repliconchromosome [GenBank: NC_013861] [Browse all T4SS(s) in this replicon]
Location [Strand]3359207..3359584 [+]
Productconjugal transfer protein TrbC
Component typeTrbC
UniProt IDD3HLJ6
KEGG IDllo:LLO_2877
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 2.9e-17, Aligned region: 7..104
Protein Sequence: 125 a.a.     [Download]
>gi|289166207|ref|YP_003456345.1| conjugal transfer protein TrbC [Legionella longbeachae NSW150]
MNQTTLFNQKNYWIMGLIVLFLLLITHPAAASSAGGGLPFDSWLTKIQKSITGPFAFSAAIIGLVAAGAT
LIFGGELNGFMRSLVFFVLVLSFLVAAQNTMTAITGKGAEISKPAVGIIATESQL
 
Nucleotide Sequence: 378 bp     [Download]
>gi|289163353|ref|NC_013861.1|:3359207-3359584 Legionella longbeachae NSW150 chromosome, complete genome
ATGAATCAAACAACTCTATTTAACCAAAAGAACTACTGGATAATGGGATTAATCGTTTTATTTTTGTTGT
TAATCACTCATCCAGCCGCAGCTTCCTCTGCCGGAGGGGGACTTCCCTTCGATTCATGGCTGACTAAAAT
TCAAAAATCCATTACAGGCCCTTTTGCCTTTAGTGCTGCCATCATCGGATTGGTTGCAGCAGGAGCGACG
CTTATTTTTGGCGGTGAATTAAATGGATTTATGCGATCTCTTGTCTTTTTTGTGTTGGTGCTCTCATTTC
TGGTAGCTGCTCAAAATACCATGACAGCAATTACTGGCAAAGGCGCTGAAATTTCTAAACCAGCTGTTGG
AATTATTGCAACGGAGTCTCAGTTATGA
 Primer design