SecReT4
Protein ID: 289166211
T4SS name [ID]Trb [55]
Gene symboltrbG
Locus tagLLO_2881
StrainLegionella longbeachae NSW150
Repliconchromosome [GenBank: NC_013861] [Browse all T4SS(s) in this replicon]
Location [Strand]3363142..3364017 [+]
Productconjugal transfer protein trbG precursor
Component typeTrbG
UniProt IDD3HLK0
KEGG IDllo:LLO_2881
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 1.4e-57, Aligned region: 68..290
Protein Sequence: 291 a.a.     [Download]
>gi|289166211|ref|YP_003456349.1| conjugal transfer protein trbG precursor [Legionella longbeachae NSW150]
MKKIILYFGLMLPLTSFAVDNTEFANFYFSKDIPALTNQEKQALRIAEEWQKGDKTSKPFHSSDGSVSFV
YGSGQTRVVCAPLQVCDIALQQGEQLNDMNVGDPRFLVEPSITGSDMDQQIHLLIKPKDVGLDTSLVITT
DRRTYHFRLKSDQNDFMPYVSFTYPDDAKAKWRLIQHMQAERRKANTFTETNEYLGDLHFNYRIQGNSRF
KPVRVYNNGVKTIIEMPGSMSESEAPALLVLRNGGLFKKPESVMVNYRLQGCRYIVDSVFDKAILIIGSG
SSQEKITITRC
 
Nucleotide Sequence: 876 bp     [Download]
>gi|289163353|ref|NC_013861.1|:3363142-3364017 Legionella longbeachae NSW150 chromosome, complete genome
ATGAAAAAAATAATTCTTTACTTTGGTTTGATGCTTCCTTTGACAAGCTTTGCTGTGGACAACACAGAGT
TTGCTAATTTCTATTTTTCTAAAGACATTCCGGCACTCACGAATCAGGAAAAGCAGGCTTTACGCATTGC
AGAAGAATGGCAGAAAGGTGACAAAACCAGTAAACCGTTCCATTCCTCAGATGGTTCGGTAAGTTTTGTT
TATGGTTCGGGTCAAACCCGAGTTGTATGTGCGCCATTACAGGTTTGTGACATTGCTTTACAGCAAGGTG
AACAGCTTAATGATATGAATGTAGGCGATCCACGTTTTCTCGTTGAGCCTTCGATTACGGGTTCAGACAT
GGATCAACAAATCCACTTGTTAATTAAACCCAAAGATGTTGGGCTAGATACTTCTCTAGTTATTACTACA
GATAGAAGAACGTATCACTTTAGATTGAAGTCAGATCAAAACGATTTTATGCCCTATGTCTCCTTTACTT
ATCCAGATGATGCCAAAGCTAAATGGCGTTTGATTCAGCACATGCAAGCAGAAAGGCGAAAAGCCAATAC
ATTCACCGAAACCAACGAATATTTAGGCGATCTTCATTTCAATTACAGGATACAAGGCAATTCCCGATTT
AAACCGGTTCGGGTTTATAACAATGGCGTGAAAACCATTATTGAAATGCCTGGAAGCATGTCTGAAAGCG
AAGCCCCTGCACTACTGGTCTTAAGAAATGGTGGTTTGTTTAAAAAACCAGAATCGGTGATGGTCAATTA
TCGCCTGCAGGGCTGCCGATATATTGTTGATAGTGTGTTCGACAAGGCAATACTGATTATCGGAAGTGGC
TCTTCTCAAGAAAAAATTACCATTACGAGGTGCTAG
 Primer design