SecReT4
Protein ID: 289166216
T4SS name [ID]Trb [55]
Gene symboltrbL
Locus tagLLO_2886
StrainLegionella longbeachae NSW150
Repliconchromosome [GenBank: NC_013861] [Browse all T4SS(s) in this replicon]
Location [Strand]3366674..3368059 [+]
Productconjugal transfer protein trbL
Component typeTrbL
UniProt IDD3HLK5
KEGG IDllo:LLO_2886
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 3.5e-35, Aligned region: 63..275
Protein Sequence: 461 a.a.     [Download]
>gi|289166216|ref|YP_003456354.1| conjugal transfer protein trbL [Legionella longbeachae NSW150]
MKKKTLTYLIVFLLIGFSVSAHAQGMDSRDLLDNILYRFSTTASTWSQTILNYARYLFWSLALISMVWTY
GLMSLRRADIQEFMAETVRFLVVVGFFYWILDNGPAIATAIIDSMRQLAAKASGIDTHISPSDIIDVGFD
IVSKAIDNSSLWSPAATTVGLIVAGVILVVLALVSINMLIILITAWILTYGGIILLGFGGGRWTQDIAIQ
YYKTVLGIALQAFAMILIIGIGKSFVDQYYAAMAKDILLKEMFVMLVVAILLLILINKIPPVLANIVSGG
GGGGSGGIGLGGALGAAGIAGAALASSAGAVSAQSAGGLSALHAAFKAASQSMGTGDLGSASEGNISSKT
GSLAQAMGQASKFAGSFGSHLASGAFDVAREKASAVKEAIAATVAKTPGGKIADAIAQRVESQNDLSTSE
HQDCAFQNITSIGAPEGSFSAGENDDEVSHFVSRKASGESQ
 
Nucleotide Sequence: 1386 bp     [Download]
>gi|289163353|ref|NC_013861.1|:3366674-3368059 Legionella longbeachae NSW150 chromosome, complete genome
ATGAAAAAAAAGACACTCACTTATTTAATCGTATTCCTTTTAATTGGGTTTTCCGTGTCCGCCCATGCAC
AAGGCATGGACAGCAGGGATTTGCTGGATAATATTCTGTATCGTTTTTCCACTACAGCCTCTACATGGAG
CCAAACCATATTAAATTATGCTCGATACCTCTTCTGGTCTCTGGCATTAATTAGCATGGTATGGACCTAT
GGGCTTATGTCATTACGAAGAGCGGATATTCAGGAATTTATGGCTGAAACGGTTCGATTTTTAGTAGTTG
TCGGTTTTTTCTATTGGATTTTGGATAATGGACCTGCCATTGCAACCGCAATCATCGATTCCATGCGACA
ACTCGCAGCTAAGGCTTCCGGCATTGATACGCACATTTCCCCCTCTGACATTATTGACGTAGGTTTTGAT
ATTGTGTCAAAAGCAATTGATAACTCCTCCCTCTGGTCCCCTGCGGCAACAACGGTGGGATTGATCGTTG
CAGGAGTGATTCTAGTCGTTTTGGCACTGGTCAGTATTAACATGCTAATTATTCTGATTACTGCCTGGAT
TTTAACCTATGGTGGAATCATCTTGTTGGGTTTTGGTGGTGGGAGATGGACTCAGGATATCGCAATTCAA
TACTACAAAACAGTGTTGGGTATTGCATTACAGGCATTTGCGATGATTTTGATTATTGGTATTGGTAAGT
CTTTTGTCGATCAATATTATGCGGCTATGGCAAAGGACATTCTACTAAAAGAAATGTTCGTGATGCTCGT
TGTAGCCATTCTTTTGCTGATATTGATTAATAAAATCCCTCCTGTTCTTGCCAATATTGTATCTGGTGGT
GGCGGCGGAGGCAGCGGTGGTATTGGCCTGGGTGGCGCTTTAGGCGCAGCAGGCATTGCAGGTGCTGCTT
TGGCAAGCAGCGCAGGAGCTGTCAGTGCTCAAAGTGCTGGAGGATTATCCGCGCTACATGCGGCATTCAA
AGCGGCTTCCCAAAGTATGGGGACTGGTGATTTAGGTTCCGCTTCAGAGGGCAATATCAGTTCCAAAACT
GGTAGTTTGGCACAAGCCATGGGACAGGCTTCAAAATTCGCCGGTTCGTTTGGCTCTCATTTGGCATCAG
GGGCATTTGATGTAGCTCGTGAAAAGGCAAGTGCTGTAAAGGAGGCAATCGCTGCAACAGTGGCCAAAAC
TCCTGGTGGGAAGATTGCTGATGCAATTGCCCAACGAGTGGAGTCGCAAAACGATTTATCAACATCTGAA
CACCAGGATTGTGCATTTCAAAATATTACTTCGATAGGCGCTCCAGAAGGAAGTTTCAGTGCTGGAGAAA
ACGACGATGAAGTCAGCCACTTTGTCAGTCGAAAAGCTTCTGGGGAGAGCCAATGA
 Primer design