SecReT4
Protein ID: 289168169
T4SS name [ID]Tra_Tn [651]
Gene symbol-
Locus tagsmi_1330
StrainStreptococcus mitis B6
Repliconchromosome [GenBank: NC_013853] [Browse all T4SS(s) in this replicon]
Location [Strand]1331973..1334426 [+]
ProductATP/GTP-binding protein
Component typeOrf16_Tn
UniProt IDD3H9M8
KEGG IDsmb:smi_1330
PDB IDNA
Domain hit(s) vs Pfam AAA_10 [PF12846], Evalue: 1.6e-34, Aligned region: 468..763
Protein Sequence: 817 a.a.     [Download]
>gi|289168169|ref|YP_003446438.1| ATP/GTP-binding protein [Streptococcus mitis B6]
MAYPIKYMEDNLVFNHDGEVFAYYELIPYNYSFLSSDEKIQVHDNFCQLIAQNRDGKIHALQLATESSIR
ATQEQSKKEITGRLKEIAYEKIDEQTEALISMIGDNQVDYRFFIGFKLYLNEQEVSVKNVGKEIQKAFAE
FFHGVNHKLMGDFVSMPMAEIERFSKMEQLLESKLSRRFQIRKLEKDDFGYIIEHLYGQTGVPFDDYDYH
LPKRYEDKKVLVKKYDILKPTRCLIEENQRYLRIEQEDTTTYVAYFTINSIVGELDFPNSEIFYYQQQQF
TFPVDTSMNVEIVANKKALSTVRNKKKELKDLDSHAWESDNETSTNVVDALESVDELESNLDQTKESMYK
LSYVVRVSAKNLDELKQRCDEVKDFYDDLSIKLVRPFGDMLGLHNEFIPSSKRYINDYIQYVTSDFLAGL
GFGATQMIGENSGIYVGYNLDTGRNIYLQPSLASQGIKGSVTNALASAFIGSLGGGKSFSNNMLVYYSVL
FGGQATIVDPKAERGEWKETLPDIAHEINIVNLTSENDNKGLLDPYVILKLPKDSESLAIDILTFLTGIS
SRDSEKFPVLRKAIRSVTQSKQRGLLLVIDELRKEDTPISNSIADHIESFVDYDFAHLLFSDGSVTQSIS
LEKQLNIIQVADLVLPDSNSSFEEYTTMELLSVAMLIVISTFALDFIHSDRSIFKIVDLDEAWSFLQVAQ
GKALSMRLVRAGRAMNAGVYFVTQNADDLLDEKMKNNIGLKFAFRSTDLVEIKKTLEFFGVDKEDENNQK
RLRELENGQCLVSDIYGRVGVMQFHPIFEELLHAFDTRPPVRNEVEE
 
Nucleotide Sequence: 2454 bp     [Download]
>gi|289166909|ref|NC_013853.1|:1331973-1334426 Streptococcus mitis B6, complete genome
ATGGCATATCCGATTAAATATATGGAAGATAATCTCGTATTTAATCATGATGGCGAAGTATTCGCTTATT
ATGAATTAATTCCCTATAATTACAGTTTTTTAAGTTCCGATGAAAAAATTCAAGTTCATGATAATTTCTG
TCAATTGATTGCCCAAAATCGTGATGGCAAGATTCATGCTCTGCAACTAGCAACCGAATCAAGTATTCGA
GCCACACAGGAACAATCGAAAAAAGAAATCACTGGACGATTAAAAGAGATAGCTTACGAAAAAATAGATG
AACAGACCGAAGCGTTAATTTCTATGATTGGTGACAATCAAGTAGACTATCGCTTTTTTATTGGTTTTAA
ACTCTACCTCAATGAACAGGAAGTATCCGTAAAAAATGTTGGGAAAGAAATTCAAAAAGCATTTGCGGAA
TTCTTTCATGGTGTGAATCACAAATTAATGGGCGATTTTGTTTCTATGCCTATGGCGGAAATCGAACGCT
TTTCTAAGATGGAACAGTTGTTAGAAAGTAAATTATCCAGACGCTTTCAGATTCGTAAATTGGAGAAAGA
TGATTTTGGTTATATTATTGAACATCTTTACGGGCAAACAGGTGTCCCTTTTGATGACTACGACTACCAT
TTACCGAAACGATACGAAGATAAAAAAGTGTTGGTAAAGAAATACGATATTCTCAAACCCACTCGCTGTT
TAATCGAAGAAAATCAACGCTATTTACGGATTGAACAGGAAGATACCACTACTTATGTGGCGTATTTTAC
AATTAATAGTATTGTTGGTGAATTGGATTTCCCTAATAGTGAAATTTTTTATTACCAGCAACAGCAGTTT
ACTTTCCCCGTTGATACCAGTATGAATGTTGAAATTGTCGCCAATAAAAAAGCCTTATCTACCGTTCGCA
ATAAAAAGAAAGAACTGAAAGATTTAGATAGCCACGCATGGGAAAGCGACAACGAAACCAGTACTAATGT
GGTGGACGCTTTAGAATCTGTCGATGAATTAGAAAGTAATTTAGACCAAACCAAAGAATCTATGTACAAA
CTAAGCTATGTGGTACGGGTATCGGCAAAGAATTTGGACGAGCTGAAACAACGTTGTGATGAAGTAAAAG
ATTTTTATGATGATCTGTCTATCAAATTAGTACGACCTTTTGGCGATATGCTAGGCTTGCATAATGAATT
TATTCCCTCAAGCAAGCGATATATCAATGACTATATTCAATATGTCACGTCGGATTTTTTGGCTGGTCTT
GGTTTCGGTGCTACACAAATGATTGGTGAAAATTCTGGTATTTACGTCGGTTACAATCTCGATACAGGCA
GAAATATTTATCTCCAACCTAGCCTTGCAAGTCAAGGAATTAAAGGCTCTGTAACAAATGCATTAGCGTC
CGCTTTTATTGGTTCATTAGGTGGCGGAAAATCATTCTCTAACAATATGCTGGTCTATTATTCAGTACTC
TTTGGCGGACAGGCAACCATTGTTGACCCAAAAGCTGAACGTGGTGAATGGAAAGAAACCTTACCTGATA
TTGCCCATGAAATCAATATTGTTAATCTCACGAGTGAGAACGACAATAAAGGGTTACTTGACCCTTATGT
GATTTTAAAACTCCCGAAAGATTCAGAAAGCCTTGCCATTGATATTCTCACGTTCTTAACAGGTATTTCC
AGCCGAGATAGCGAGAAGTTTCCTGTCCTGCGTAAAGCTATTCGGAGTGTAACTCAAAGCAAACAACGAG
GGTTGTTATTGGTGATTGATGAATTGCGAAAAGAAGATACGCCCATCAGCAATAGTATTGCTGACCATAT
CGAAAGCTTTGTCGATTATGATTTTGCCCATCTGTTATTCAGTGATGGCAGTGTCACCCAATCCATTAGC
TTGGAAAAACAACTCAATATTATTCAAGTGGCAGATTTGGTCTTACCCGATTCCAATAGCTCTTTTGAAG
AATACACTACCATGGAATTATTAAGTGTGGCAATGCTGATTGTCATTAGTACCTTTGCTTTAGACTTTAT
CCACTCTGACCGTTCCATTTTTAAAATTGTTGACCTTGATGAGGCTTGGAGTTTTTTACAAGTGGCACAA
GGAAAAGCTCTATCTATGCGATTGGTTCGAGCAGGACGTGCCATGAATGCAGGGGTCTATTTCGTTACTC
AAAACGCGGACGATTTACTAGATGAAAAGATGAAGAATAATATTGGCTTGAAATTTGCCTTTCGTTCCAC
TGACCTAGTGGAAATCAAAAAGACCTTAGAATTTTTTGGTGTGGACAAGGAAGATGAAAACAATCAGAAA
CGCTTACGTGAATTAGAAAATGGACAATGTTTAGTTTCAGACATCTATGGTCGTGTAGGGGTTATGCAGT
TTCACCCGATTTTTGAAGAGTTGCTTCATGCCTTTGATACCAGACCGCCTGTGCGAAATGAGGTGGAAGA
ATGA
 Primer design