SecReT4
Protein ID: 289168170
T4SS name [ID]Tra_Tn [651]
Gene symbol-
Locus tagsmi_1331
StrainStreptococcus mitis B6
Repliconchromosome [GenBank: NC_013853] [Browse all T4SS(s) in this replicon]
Location [Strand]1334423..1336450 [+]
Producttransmembrane amino acid transporter protein
Component typeOrf15_Tn
UniProt IDD3H9M9
KEGG IDsmb:smi_1331
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 675 a.a.     [Download]
>gi|289168170|ref|YP_003446439.1| transmembrane amino acid transporter protein [Streptococcus mitis B6]
MTQKQKKFLHYSWITLLCVGVILLLLGTLGNAVQATGLVDETIDTSNEYSKYGLNQYQLDYYVDNSWGWL
PWNWSDGIGQSVMYGLYAITNFIWTISLYLSNATGYLVKEAYTLDFISQTSQAIGENMQTIAGITPNGFS
SSGFYVGFLLLFILIVGIYVAYTGLVKRETTKVIRAVLNFVVVFILSASFIAYAPDYIAKINDFSKDVST
ASLNIGTKIVLPNTDSQGKDSVDMIRDSLFSVQVKQPWLLLQYGSTDVEALGEERVESLLSTSPDTNNGE
DRENVVIEEIEDHDNTYLTLPKTISRLGTVFFLFVFNIGISIFVFLLTGIMIFSQVLFIIFAMFLPISFL
LSMLPSFDGMGRHAITKLFNVIMTRAGITLIITVAFSISTMLYSLSASSPFFMIMFLQIVTFAGIYFKLG
DLMSLFSLQSNDSQNMGRQVFRRPRQMMNRQTRRFQRSMSKIFRGKAGSTKQKTMTTKQNQTNKANHTRQ
NERTTPKKETALSNVKKQQGGIGQRLGEKTAHVLDTKNRLVNKRKQAKQQIQATPTHVKYALHQGKENVT
HNVTDFKQSMADTKAQRKQQRMNQQEQKRKNIVQKRLELDKAKEKRRKENPSSPVQNNQQHVRKRQQTVT
PVLSQNTKRENHQRPLKKEQKQKTPPKQFNQRKLNKRTDKRGQQT
 
Nucleotide Sequence: 2028 bp     [Download]
>gi|289166909|ref|NC_013853.1|:1334423-1336450 Streptococcus mitis B6, complete genome
ATGACACAAAAACAAAAGAAATTTCTTCACTATAGTTGGATAACGCTCCTTTGTGTGGGCGTTATTTTAC
TTTTATTAGGCACGCTGGGCAATGCAGTACAAGCGACAGGCTTAGTTGATGAAACCATTGATACAAGCAA
TGAATACTCCAAGTATGGTTTGAATCAATATCAGCTTGATTATTATGTGGACAATAGCTGGGGCTGGCTT
CCATGGAATTGGAGTGATGGCATAGGACAATCGGTGATGTATGGATTGTATGCCATTACTAATTTTATTT
GGACAATTTCTCTTTATCTATCGAACGCCACAGGTTATTTGGTGAAAGAAGCCTATACCTTAGATTTCAT
TAGTCAAACATCCCAAGCAATTGGCGAAAACATGCAGACGATTGCAGGCATTACACCGAATGGCTTTTCC
AGTTCAGGGTTTTATGTCGGTTTCCTCCTTCTTTTTATTCTCATTGTTGGAATCTATGTTGCCTATACAG
GATTGGTTAAGCGAGAAACGACGAAAGTGATACGAGCTGTTTTAAACTTTGTCGTGGTGTTTATTCTATC
GGCTTCCTTTATTGCGTATGCACCCGATTATATTGCGAAAATCAATGATTTTTCCAAAGATGTCAGTACC
GCCAGTCTGAATATTGGGACAAAAATTGTTCTTCCTAACACGGATAGTCAAGGGAAAGACAGTGTGGACA
TGATACGTGACAGCTTATTCTCTGTTCAAGTAAAGCAACCATGGCTATTGCTTCAATATGGCTCCACTGA
TGTAGAAGCGTTAGGGGAAGAACGTGTGGAAAGTTTATTGTCTACCAGTCCAGATACAAACAATGGTGAA
GATAGAGAAAATGTAGTGATTGAAGAAATTGAAGATCATGACAATACCTATTTAACCCTACCGAAGACGA
TTTCCAGATTAGGAACAGTCTTCTTTTTGTTTGTATTCAATATTGGTATCTCGATTTTTGTTTTCCTTCT
AACAGGAATCATGATTTTTTCGCAAGTGCTATTTATTATTTTCGCTATGTTTTTGCCAATCAGTTTCCTA
TTAAGTATGTTGCCGAGTTTTGATGGCATGGGCAGGCATGCCATTACCAAGTTATTTAATGTGATTATGA
CAAGGGCTGGTATTACCTTGATTATTACCGTTGCCTTTAGTATTTCCACTATGCTTTATTCGCTGTCAGC
AAGTTCTCCCTTTTTCATGATTATGTTTTTACAAATTGTGACCTTTGCAGGGATTTATTTTAAACTGGGC
GATTTAATGAGCCTATTCTCTTTACAAAGCAACGACTCTCAAAACATGGGCAGACAAGTGTTTCGCAGAC
CTCGTCAAATGATGAATCGACAAACCAGAAGATTTCAACGCAGTATGAGTAAGATTTTTCGTGGAAAAGC
AGGGTCAACGAAGCAAAAGACAATGACAACAAAGCAGAATCAAACCAATAAAGCTAACCATACTCGTCAA
AATGAACGGACTACACCAAAGAAAGAAACAGCACTTTCCAATGTGAAAAAGCAACAAGGCGGTATCGGGC
AACGATTAGGTGAAAAGACAGCCCATGTATTGGACACGAAAAATCGTCTAGTCAATAAAAGAAAGCAGGC
TAAACAACAGATACAGGCGACACCAACCCATGTCAAATATGCCCTTCATCAAGGAAAAGAGAATGTCACT
CATAATGTAACAGACTTTAAACAATCTATGGCAGATACCAAAGCTCAACGCAAACAACAGCGTATGAACC
AGCAGGAGCAAAAACGAAAGAACATTGTTCAAAAGCGTTTGGAGCTGGATAAAGCAAAAGAAAAAAGACG
AAAAGAAAACCCATCATCTCCTGTTCAGAATAACCAGCAGCATGTTCGCAAGCGTCAGCAAACCGTCACG
CCTGTTTTGTCACAAAACACTAAACGTGAAAATCATCAGCGACCATTGAAAAAAGAGCAAAAACAAAAGA
CACCACCGAAGCAATTCAATCAGAGGAAGCTAAATAAAAGAACGGATAAGCGAGGACAACAAACATGA
 Primer design