SecReT4
Protein ID: 289168171
T4SS name [ID]Tra_Tn [651]
Gene symbol-
Locus tagsmi_1332
StrainStreptococcus mitis B6
Repliconchromosome [GenBank: NC_013853] [Browse all T4SS(s) in this replicon]
Location [Strand]1336447..1337469 [+]
Productcell wall hydrolase, lytic transglycosylase
Component typeOrf14_Tn
UniProt IDD3H9N0
KEGG IDsmb:smi_1332
PDB IDNA
Domain hit(s) vs Pfam Lysozyme_like [PF13702], Evalue: 2.1e-61, Aligned region: 49..205
NLPC_P60 [PF00877], Evalue: 5.2e-28, Aligned region: 230..336
Protein Sequence: 340 a.a.     [Download]
>gi|289168171|ref|YP_003446440.1| cell wall hydrolase, lytic transglycosylase [Streptococcus mitis B6]
MKLKITVICSVVFSLFFFLLLFLVIFFADDTDSGENNKDSSISQGGVTVSPEVLAHRPLIEKYGKEYGIE
DYVSYILAIMQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGVKYFSELLTSAEQQGVDIDSVIQSYN
YGGGFLNYVRSHGKKYTYELAEQFSKEKSGGQKADYPNPIAIPVNGGWRYNYGNQFYVQLVSQYLTDTSP
TEFDDETVQVIMDEALKYEGFPYVFGGASPTTSFDCSGLIQWVYDKAGISLPRVAQDQYDATQEISMEEA
QAGDLIFFHSTYNAGTYVTHVAIYLEGNRFYHAGDPIGYGDLSSRYWQDHLIGARRVIHN
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|289166909|ref|NC_013853.1|:1336447-1337469 Streptococcus mitis B6, complete genome
ATGAAGCTAAAAATAACAGTGATTTGTAGTGTGGTCTTCTCTCTCTTCTTTTTTCTCTTATTATTCCTAG
TCATTTTCTTTGCAGATGATACGGACAGTGGCGAAAACAACAAGGATTCTTCTATTTCACAAGGCGGTGT
GACCGTTTCACCAGAAGTGTTGGCACACCGTCCGTTGATTGAAAAATATGGTAAGGAATATGGGATTGAA
GACTATGTTTCTTATATCTTAGCCATTATGCAAGTGGAATCGGGCGGTACAGCAGAAGATGTTATGCAAA
GTTCCGAATCTTTGGGTTTACCGCCCAACAGTTTGAGTACCGAAGAGTCCATCAAACAAGGGGTTAAATA
TTTCAGTGAATTATTAACCAGTGCAGAACAACAAGGAGTGGATATAGATTCTGTTATCCAATCTTATAAT
TATGGCGGTGGCTTTTTAAATTATGTGAGGAGTCATGGGAAAAAATATACCTATGAATTAGCCGAACAGT
TTTCTAAAGAGAAGTCGGGTGGTCAAAAAGCAGACTATCCCAATCCCATAGCCATACCTGTGAATGGTGG
TTGGCGATATAACTATGGAAATCAGTTTTATGTTCAGTTGGTTTCACAATACCTAACCGACACTTCCCCA
ACAGAATTTGATGATGAAACCGTGCAAGTCATTATGGACGAAGCCTTGAAATACGAAGGGTTTCCCTATG
TCTTTGGAGGGGCGTCGCCTACCACCTCTTTTGATTGTAGTGGCTTAATACAATGGGTGTATGACAAAGC
TGGCATTTCTCTCCCTCGTGTCGCCCAAGATCAGTATGACGCTACGCAAGAAATCTCTATGGAAGAAGCC
CAAGCAGGCGACCTTATCTTCTTTCATTCAACCTATAATGCAGGCACATATGTGACTCATGTGGCGATAT
ATTTAGAGGGAAATCGCTTTTATCATGCAGGCGACCCAATCGGTTATGGCGACTTAAGCAGTCGTTATTG
GCAAGACCATCTGATTGGGGCTAGACGTGTTATTCATAACTAA
 Primer design