SecReT4
Protein ID: 290243101
T4SS name [ID]Trb [632]
Gene symbol-
Locus tagTK90_2819
StrainThioalkalivibrio sp. K90mix
Repliconplasmid pTK9001 [GenBank: NC_013930] [Browse all T4SS(s) in this replicon]
Location [Strand]174482..174850 [+]
ProductConjugal transfer protein TrbC
Component typeTrbC
UniProt IDD3SGR3
KEGG IDtkm:TK90_2819
PDB IDNA
Domain hit(s) vs Pfam TrbC [PF04956], Evalue: 8.7e-14, Aligned region: 14..111
Protein Sequence: 122 a.a.     [Download]
>gi|290243101|ref|YP_003494771.1| Conjugal transfer protein TrbC [Thioalkalivibrio sp. K90mix]
MVTQEALERAGRVFVACLPAILVLVGLWPESLMAQDGGRGISDDRVPWIETLTQIRDSFCGPVAHYTVVI
AIVVTGLTMAFGEIQGMALTLMRVVMGSSIALMAVKFIGAFGFGDAECTARM
 
Nucleotide Sequence: 369 bp     [Download]
>gi|290242889|ref|NC_013930.1|:174482-174850 Thioalkalivibrio sp. K90mix plasmid pTK9001, complete sequence
ATGGTCACACAGGAGGCGCTTGAACGGGCGGGCCGGGTCTTCGTGGCCTGCCTGCCCGCAATACTGGTTT
TGGTCGGTCTGTGGCCTGAGAGCCTCATGGCGCAGGACGGCGGGCGTGGGATTTCGGACGACCGGGTCCC
CTGGATCGAAACGCTCACCCAGATCCGGGACTCATTCTGTGGCCCGGTCGCGCACTACACCGTGGTAATC
GCGATCGTGGTGACTGGCCTGACGATGGCGTTCGGGGAGATTCAGGGTATGGCGCTCACGCTGATGCGCG
TGGTGATGGGGTCATCGATCGCTTTGATGGCGGTGAAGTTTATTGGCGCCTTCGGGTTCGGCGACGCCGA
ATGCACCGCTCGGATGTGA
 Primer design