SecReT4
Protein ID: 290243105
T4SS name [ID]Trb [632]
Gene symbol-
Locus tagTK90_2823
StrainThioalkalivibrio sp. K90mix
Repliconplasmid pTK9001 [GenBank: NC_013930] [Browse all T4SS(s) in this replicon]
Location [Strand]178482..179588 [+]
ProductTrbL/VirB6 plasmid conjugal transfer protein
Component typeTrbL
UniProt IDD3SGR7
KEGG IDtkm:TK90_2823
PDB IDNA
Domain hit(s) vs Pfam TrbL [PF04610], Evalue: 4.9e-16, Aligned region: 48..326
Protein Sequence: 368 a.a.     [Download]
>gi|290243105|ref|YP_003494775.1| TrbL/VirB6 plasmid conjugal transfer protein [Thioalkalivibrio sp. K90mix]
MGDRLSIGDAIELIMEYALAPLVMANELAVTLADRMTMVSLTLMDIFLVIMVVYAGLKMAVSNTMDSSDF
IFGMIKMVVFWAIIYWMVNNYSDLIDRFFDGFDRLNQTIAEETLAAGQSAGLGEAAEGVDAGSVLSDDAI
AGQATLEALGVYIDEFSAGLAEARSEAWARVADASWRAKVPQSFRAFVFWLYAGLLQLVAIAFVMLFLVL
YTIVLVTVMFMKAVVVAVGPLMLMFFLVPYLSFLSDGWVRSAITVGLTMMMITIVMSIFGGVMWMVMGGV
PLGREGFEGMTISQLYGYYDFQIILPLIFVTLIGGYMMLQAPQLAEMMMNGRQMGMAMGRGASQGAQKGG
AAANAGARSALNKMRGRK
 
Nucleotide Sequence: 1107 bp     [Download]
>gi|290242889|ref|NC_013930.1|:178482-179588 Thioalkalivibrio sp. K90mix plasmid pTK9001, complete sequence
ATGGGTGACAGGCTGAGTATCGGAGACGCCATCGAATTGATCATGGAGTACGCATTGGCTCCATTGGTCA
TGGCGAATGAATTGGCCGTAACCCTGGCCGACCGGATGACCATGGTGTCCTTGACGCTCATGGACATCTT
TCTGGTCATCATGGTGGTTTACGCCGGGTTGAAGATGGCGGTATCGAACACCATGGATTCGAGCGATTTC
ATCTTCGGCATGATCAAAATGGTCGTCTTCTGGGCGATCATCTACTGGATGGTGAACAACTATTCGGACC
TCATCGATCGATTTTTCGATGGGTTCGATCGCCTCAATCAAACGATCGCGGAAGAAACGCTGGCGGCTGG
TCAAAGCGCGGGTCTTGGTGAAGCGGCTGAAGGTGTAGATGCGGGTAGCGTGCTCAGTGACGACGCGATC
GCGGGGCAGGCAACGCTTGAGGCGCTTGGGGTGTATATAGACGAGTTTTCGGCCGGTCTCGCCGAGGCCC
GTTCCGAAGCATGGGCGCGTGTGGCTGACGCGAGCTGGCGGGCGAAAGTTCCTCAATCGTTCCGCGCCTT
TGTGTTTTGGCTTTATGCCGGTCTCTTGCAGCTCGTCGCGATCGCCTTCGTGATGCTATTCCTGGTTCTG
TACACCATCGTTCTGGTAACGGTGATGTTTATGAAGGCAGTTGTGGTGGCCGTGGGACCGCTGATGTTGA
TGTTCTTCCTGGTGCCTTATCTGTCATTCCTCTCCGATGGCTGGGTGAGATCCGCCATAACCGTTGGATT
GACCATGATGATGATCACCATTGTCATGTCCATCTTCGGAGGCGTGATGTGGATGGTCATGGGGGGTGTG
CCGCTCGGACGAGAGGGGTTCGAGGGGATGACGATCTCGCAACTGTATGGCTATTACGACTTCCAGATCA
TTCTCCCGTTGATCTTCGTGACATTGATCGGGGGGTACATGATGTTGCAAGCGCCCCAGTTGGCCGAAAT
GATGATGAATGGTCGCCAGATGGGGATGGCGATGGGCCGAGGCGCCAGTCAGGGTGCCCAGAAAGGTGGG
GCGGCGGCCAACGCTGGGGCTCGGAGTGCCCTGAACAAAATGCGCGGCCGTAAATAG
 Primer design