SecReT4
Protein ID: 290243107
T4SS name [ID]Trb [632]
Gene symbol-
Locus tagTK90_2825
StrainThioalkalivibrio sp. K90mix
Repliconplasmid pTK9001 [GenBank: NC_013930] [Browse all T4SS(s) in this replicon]
Location [Strand]180416..181270 [+]
ProductConjugal transfer protein TrbG/VirB9/CagX
Component typeTrbG
UniProt IDD3SGR9
KEGG IDtkm:TK90_2825
PDB IDNA
Domain hit(s) vs Pfam CagX [PF03524], Evalue: 3.1e-46, Aligned region: 50..283
Protein Sequence: 284 a.a.     [Download]
>gi|290243107|ref|YP_003494777.1| Conjugal transfer protein TrbG/VirB9/CagX [Thioalkalivibrio sp. K90mix]
MKGFMHSRVLNRALALSVLALVPALALSVQSATASDMSASAEPYTFPQETRLVKFRYDENRTYEILARPD
APTNIALGENEELVALAIGDTVQWITEDVPGNIFIKPVRSGIYTAGTIVTNKRSYQISLRAVPSNGQWYQ
RVSWEHGSDGMVREARGGGESFQTSVGAAPQEQAGGQQVGPVPGLDDRVSQASTSSSPRPSDLNFGYEVR
GASGIVQSAFDDGRSLWIRMEDGLEELPAVFVQGRSTSKALANYHVDGDYIVVHQVSSRTTLRIGQDEVV
IEKG
 
Nucleotide Sequence: 855 bp     [Download]
>gi|290242889|ref|NC_013930.1|:180416-181270 Thioalkalivibrio sp. K90mix plasmid pTK9001, complete sequence
ATGAAAGGATTCATGCACTCGCGGGTGCTAAATCGAGCGCTCGCGCTATCTGTGCTTGCGCTGGTGCCAG
CTCTGGCTCTGAGCGTTCAATCGGCCACCGCGTCGGATATGTCGGCGTCCGCGGAGCCGTACACATTCCC
GCAAGAAACCCGTCTGGTGAAATTTCGCTACGACGAGAACCGCACGTACGAAATCCTCGCTCGCCCGGAT
GCGCCAACCAACATCGCTCTGGGGGAAAACGAAGAGCTTGTTGCGTTGGCGATCGGCGATACGGTTCAGT
GGATCACGGAAGATGTGCCAGGGAACATCTTCATCAAGCCCGTCCGTTCCGGTATCTATACCGCCGGCAC
GATCGTTACCAACAAGCGTTCCTACCAGATCAGCCTCCGTGCGGTACCGTCCAATGGGCAGTGGTATCAG
CGTGTTTCATGGGAGCACGGATCGGATGGAATGGTCCGTGAAGCGCGCGGTGGTGGCGAGTCATTTCAGA
CTTCGGTCGGTGCTGCCCCTCAAGAGCAGGCGGGCGGGCAACAGGTAGGCCCTGTTCCAGGACTGGATGA
TCGGGTCTCTCAAGCATCGACGTCTTCGAGCCCCCGGCCGTCGGATCTAAATTTTGGCTATGAAGTCCGG
GGTGCCTCCGGGATTGTTCAGAGCGCATTCGATGATGGTCGATCCCTCTGGATCCGGATGGAGGACGGAC
TCGAGGAGCTTCCGGCGGTGTTCGTGCAGGGCCGGTCGACAAGCAAGGCACTGGCGAACTACCACGTTGA
TGGCGATTACATCGTGGTTCATCAAGTGAGCAGCCGGACAACGCTGCGTATTGGGCAGGACGAAGTGGTG
ATCGAGAAGGGGTAG
 Primer design