SecReT4
Protein ID: 290243109
T4SS name [ID]Trb [632]
Gene symbol-
Locus tagTK90_2827
StrainThioalkalivibrio sp. K90mix
Repliconplasmid pTK9001 [GenBank: NC_013930] [Browse all T4SS(s) in this replicon]
Location [Strand]182711..183502 [+]
ProductLytic transglycosylase catalytic
Component typeTrbN
UniProt IDD3SGS1
KEGG IDtkm:TK90_2827
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 263 a.a.     [Download]
>gi|290243109|ref|YP_003494779.1| Lytic transglycosylase catalytic [Thioalkalivibrio sp. K90mix]
MLFKTIPIAGAALAFLAGPLLAETNPDEDAAERAPVTLEDAAERAPVTLEDLGVRRNNNRPLVLISRDED
GARIAHFFRRGESSAYRSVPVEEDQPRAQSAAYRSSAQKNGALARSHLAPQATIRPYEGAINTTSFQREV
IAVSQRYGVDPALVRAVVHTESSFNPSAASHANAVGLMQLIPETAERFGVVDRTDPMQSLEGGVRYLRFL
LDHFDDVEHAIAAYNAGEGAVTRHNGIPPFEETQKFVPKVLSRYQRYKEVMGS
 
Nucleotide Sequence: 792 bp     [Download]
>gi|290242889|ref|NC_013930.1|:182711-183502 Thioalkalivibrio sp. K90mix plasmid pTK9001, complete sequence
ATGTTGTTCAAGACGATCCCCATCGCAGGGGCAGCACTGGCCTTTCTGGCTGGGCCCTTGCTGGCAGAAA
CCAATCCTGACGAAGACGCGGCCGAGCGTGCCCCGGTTACGCTCGAAGACGCGGCCGAGCGTGCCCCGGT
TACGCTCGAGGACCTTGGTGTTCGCCGCAACAACAATCGCCCACTGGTCCTGATCTCCCGCGACGAAGAT
GGTGCGCGAATTGCGCATTTCTTTCGCAGGGGTGAATCGTCCGCCTACCGCTCCGTGCCGGTAGAGGAAG
ATCAACCGAGGGCGCAATCAGCCGCCTATCGTTCATCCGCTCAGAAGAACGGCGCGCTTGCCCGTTCTCA
TCTTGCCCCGCAGGCGACGATTCGCCCCTATGAGGGGGCGATCAACACCACCAGCTTTCAGCGTGAGGTG
ATCGCCGTTTCGCAACGATACGGCGTGGACCCAGCCCTCGTGCGCGCAGTGGTGCATACCGAAAGTTCAT
TCAACCCGTCCGCCGCCTCACACGCCAACGCGGTGGGGTTGATGCAGCTGATTCCTGAAACCGCGGAACG
TTTTGGTGTCGTGGATCGCACGGACCCGATGCAGAGCCTCGAGGGGGGCGTCCGGTATCTGCGCTTCCTT
CTTGATCACTTTGACGACGTGGAGCACGCCATCGCCGCCTACAACGCGGGTGAGGGGGCGGTTACGCGGC
ATAACGGTATTCCGCCGTTCGAGGAAACGCAGAAGTTCGTTCCAAAAGTCCTGTCGCGGTATCAGCGATA
CAAGGAGGTAATGGGGTCGTGA
 Primer design