SecReT4
Protein ID: 290474529
T4SS name [ID]Tfc [697]
Gene symbol-
Locus tagXBJ1_1496
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T4SS(s) in this replicon]
Location [Strand]1462145..1463578 [-]
Producthypothetical protein
Component typeTfc22
UniProt IDD3V072
KEGG IDxbo:XBJ1_1496
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 477 a.a.     [Download]
>gi|290474529|ref|YP_003467409.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MRRKSVLLIAGGLVVASVQGQTSGLSVALPAVSHSALGYGAQSSGAVSDTLFYTLGGGSVISEPASRAGS
TRLAGLELGWSSDLMCGNFDLKTTVSNQLNGITAGMKNLMSEVIQGATGAVASLPAMIIQRANPGLYDML
TNGVLQANVAFDKAQFNCQNMAKRMMDFAQNNKWSQSAALQEYKNQVNGGDGDAVRVNNAGTKATGAGGH
SWIGGQRQGGKGQNAIRPTRDLASAGFNMMNQLPVLSQSSVSTFNCEGSACRKFSTAREAAEAVVSVLGD
RAIRTCAHAAECSSGGEQHQPGTTVAGTGFAPMLEAHTKTNAEHLVKLISGTEKPTRVNLTKLKTGSLAV
TQGVIQALQRDPDKAALTARLAGELAMSETIETALLMRRMLITGMSEPNAAAQSEALAEGDRRIAALDRE
INALKNEMELKQALSRNSILTIIERDTQRIHAHPQKQVADSQDARFYQLEAPNREVR
 
Nucleotide Sequence: 1434 bp     [Download]
>gi|290473094|ref|NC_013892.1|:c1463578-1462145 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGAGAAGAAAATCGGTGCTGCTGATAGCGGGTGGGCTGGTCGTTGCCTCGGTACAGGGGCAGACATCGG
GGCTGTCGGTGGCCTTACCGGCCGTCAGTCACAGTGCACTGGGCTATGGTGCACAGAGCAGCGGGGCAGT
CTCCGATACGCTGTTTTATACCCTGGGGGGCGGCTCGGTGATTTCTGAGCCGGCCAGTCGCGCGGGGTCA
ACCCGGCTGGCCGGGCTGGAACTCGGCTGGAGTTCGGATTTGATGTGCGGAAATTTTGACCTGAAAACCA
CGGTCAGTAATCAGCTCAACGGTATCACGGCGGGCATGAAAAACCTGATGAGCGAAGTCATTCAGGGGGC
CACCGGAGCGGTTGCCAGTCTCCCTGCCATGATAATTCAGCGAGCCAACCCAGGGTTGTATGACATGCTG
ACCAACGGGGTATTGCAGGCCAATGTGGCGTTTGATAAAGCCCAGTTCAATTGTCAGAACATGGCGAAGA
GAATGATGGATTTTGCGCAGAACAACAAATGGAGCCAATCAGCGGCGTTGCAGGAGTACAAAAATCAGGT
TAACGGCGGGGATGGTGATGCTGTGCGTGTCAATAATGCCGGAACCAAAGCGACCGGCGCTGGCGGGCAC
TCGTGGATTGGCGGGCAACGACAAGGCGGGAAGGGGCAGAATGCCATTCGTCCGACCCGTGATTTAGCCA
GTGCCGGCTTTAATATGATGAATCAGTTGCCGGTACTGAGCCAGTCATCGGTCAGCACCTTCAATTGCGA
GGGCAGCGCCTGCCGTAAATTCAGCACGGCGCGGGAAGCGGCCGAGGCGGTGGTCAGTGTACTGGGCGAT
CGGGCCATCCGCACCTGCGCTCACGCGGCAGAATGCAGCAGCGGGGGTGAACAACACCAGCCGGGGACAA
CGGTCGCGGGAACGGGGTTTGCCCCGATGCTGGAAGCCCATACCAAAACGAACGCCGAACACCTGGTGAA
ACTGATCAGCGGCACGGAGAAACCCACGCGGGTGAATCTCACCAAACTGAAAACCGGCAGTCTGGCCGTG
ACGCAGGGGGTCATTCAGGCGTTGCAGCGTGACCCCGATAAGGCCGCCCTGACTGCGCGTCTGGCGGGGG
AGCTGGCGATGAGCGAGACCATTGAAACCGCGTTACTGATGCGCCGAATGCTGATCACCGGCATGTCCGA
ACCCAATGCGGCAGCACAATCGGAAGCGCTGGCAGAAGGCGACCGCCGGATTGCCGCACTGGACAGGGAA
ATTAATGCCCTGAAAAATGAAATGGAGCTGAAGCAGGCGCTTTCCCGTAATTCCATTCTGACCATTATTG
AGCGTGATACGCAGCGTATTCACGCTCATCCGCAAAAACAGGTCGCGGACAGTCAGGATGCCCGTTTTTA
TCAGTTGGAAGCCCCCAACCGTGAGGTCAGGTAA
 Primer design