SecReT4
Protein ID: 290474557
T4SS name [ID]Tfc [697]
Gene symbol-
Locus tagXBJ1_1530
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T4SS(s) in this replicon]
Location [Strand]1491970..1492344 [-]
Producthypothetical protein
Component typeTfc11
UniProt IDD3V0K8
KEGG IDxbo:XBJ1_1530
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1.4e-41, Aligned region: 1..118
Protein Sequence: 124 a.a.     [Download]
>gi|290474557|ref|YP_003467437.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MQTIPFLPDRLNAEPIVFRGFTTPEMGLAALLGLVFGLMVSLPFIPLAGWVMIPTGMLFMPLLLISFGGR
WLAQLKRGKPENYLWLTLEEKKRRLGIGDQALIIAAQGWSLRRSRLTHRNGSLR
 
Nucleotide Sequence: 375 bp     [Download]
>gi|290473094|ref|NC_013892.1|:c1492344-1491970 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGCAGACGATCCCTTTCCTGCCTGATCGCTTAAATGCCGAACCGATCGTATTCCGGGGATTCACCACAC
CGGAAATGGGGCTGGCCGCTTTGCTGGGGCTGGTGTTCGGGCTGATGGTGAGCCTTCCTTTTATCCCGTT
AGCCGGCTGGGTCATGATACCGACGGGTATGCTGTTCATGCCCTTGTTATTGATTAGTTTTGGTGGGCGC
TGGCTCGCGCAGCTTAAGCGCGGCAAACCGGAAAATTATCTCTGGCTGACGCTGGAAGAGAAAAAACGCC
GGCTGGGTATCGGTGATCAGGCATTGATTATTGCGGCTCAGGGCTGGTCGTTGCGCCGAAGCAGGCTGAC
TCATCGTAACGGGAGCCTGCGATGA
 Primer design