SecReT4
Protein ID: 290474560
T4SS name [ID]Tfc [697]
Gene symbol-
Locus tagXBJ1_1533
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T4SS(s) in this replicon]
Location [Strand]1493001..1493330 [-]
Producthypothetical protein
Component typeTfc9
UniProt IDD3V0L1
KEGG IDxbo:XBJ1_1533
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 4.5e-21, Aligned region: 24..103
Protein Sequence: 109 a.a.     [Download]
>gi|290474560|ref|YP_003467440.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MRGDFSLSRSVCLLGLTVLCMPLAQAAEKDELASAKNLIEQVQMALERANLAEKQADTPTRPRYDFDYLR
IKADLNTIKAGIDHYLTPSRARQQASGTLSGHYRQEHPQ
 
Nucleotide Sequence: 330 bp     [Download]
>gi|290473094|ref|NC_013892.1|:c1493330-1493001 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGCGTGGTGACTTTTCTTTGTCCCGTTCTGTCTGTCTGCTGGGGTTGACTGTGCTGTGTATGCCGCTTG
CGCAGGCGGCCGAGAAAGACGAACTGGCGAGTGCAAAAAATCTGATTGAGCAGGTGCAGATGGCGCTGGA
GCGTGCAAACCTCGCCGAAAAGCAGGCTGACACCCCAACCCGCCCTCGCTATGACTTTGATTACCTCCGT
ATCAAAGCGGATCTCAACACCATCAAAGCCGGTATCGATCACTATCTGACCCCTTCCCGCGCCCGGCAGC
AGGCGTCAGGCACGCTATCCGGTCATTACCGTCAGGAACATCCGCAATGA
 Primer design