SecReT4
Protein ID: 290474562
T4SS name [ID]Tfc [697]
Gene symbol-
Locus tagXBJ1_1535
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T4SS(s) in this replicon]
Location [Strand]1494260..1495018 [-]
Producthypothetical protein
Component typeTfc8
UniProt IDD3V0L3
KEGG IDxbo:XBJ1_1535
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 1.2e-70, Aligned region: 50..249
Protein Sequence: 252 a.a.     [Download]
>gi|290474562|ref|YP_003467442.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MAQSENQSRPSSQPPRKHGLLYRLLWECPWQLIGFVVMSWLFSLLLEYLGMAFFWPEQGAAHSQTMMKAE
LNYLSSEFTRSLLLTEPSQTVLAWLAQVYQWLFVDSGFMNWVQGQRQYQLHNNNDFMREFNTVLHGISAH
LQEYWLATVFITMVTLIRLGILLLSVPLFVMVVLVALVDGLGRRDLRRYGAGYESSFVYHHAKRGIKPAC
TVPCVLYLSWPEVVYPTVILLPAAIVLGIAIVITTSMFKKYI
 
Nucleotide Sequence: 759 bp     [Download]
>gi|290473094|ref|NC_013892.1|:c1495018-1494260 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGGCTCAGTCAGAAAATCAGTCCCGCCCATCTTCCCAACCGCCCCGCAAGCATGGCCTGTTGTATCGTC
TGTTATGGGAATGCCCGTGGCAGCTCATTGGCTTTGTGGTGATGTCCTGGCTATTCAGCCTGTTACTGGA
ATATCTCGGTATGGCTTTTTTCTGGCCGGAACAGGGTGCCGCTCACAGTCAGACTATGATGAAGGCAGAG
CTTAATTATCTCTCCTCGGAATTTACCCGAAGTCTGTTATTGACAGAACCTTCACAAACCGTTTTGGCAT
GGCTGGCACAGGTTTATCAGTGGCTGTTTGTGGACAGTGGTTTTATGAACTGGGTTCAAGGGCAGAGGCA
ATATCAGCTCCATAACAACAATGATTTTATGCGTGAATTCAATACGGTATTACATGGCATATCGGCGCAT
TTGCAAGAATATTGGCTGGCCACGGTATTTATCACGATGGTGACGCTGATCCGGCTGGGGATCCTGCTGT
TATCCGTGCCCCTGTTTGTAATGGTGGTGTTAGTGGCACTGGTTGACGGGCTGGGACGACGGGATTTGCG
GCGCTACGGAGCCGGGTATGAATCCAGTTTTGTCTATCACCATGCCAAGCGAGGGATAAAACCGGCCTGC
ACGGTTCCCTGTGTACTGTATTTATCGTGGCCGGAGGTGGTGTATCCCACGGTAATCTTGTTGCCTGCGG
CGATAGTGCTGGGCATAGCGATTGTGATAACAACATCCATGTTTAAGAAATATATTTAG
 Primer design