SecReT4
Protein ID: 290476362
T4SS name [ID]Tfc [698]
Gene symbol-
Locus tagXBJ1_3384
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T4SS(s) in this replicon]
Location [Strand]3298328..3298864 [+]
ProductPilL protein (fragment)
Component typeTfc2
UniProt IDD3V4C3
KEGG IDxbo:XBJ1_3384
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 178 a.a.     [Download]
>gi|290476362|ref|YP_003469266.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MRITVLMGVLVTILTGCNAPSNKPPSQCASEKAISATQLTRNIQPVSPDIYQQAPEVVRYGRYILVSTDP
TAAQRDPLSQLIEVHIPASQHPTVADALRDVLRQSGYRLCAPEKTNDILYRQPLPSVHYQLGPVRLRTAL
QLMAGPAWQLEVDEVQREVCHHLRPGYQLPQPRQGKQP
 
Nucleotide Sequence: 537 bp     [Download]
>gi|290473094|ref|NC_013892.1|:3298328-3298864 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGAGAATAACCGTATTAATGGGTGTATTGGTCACTATCCTGACGGGTTGCAATGCCCCGTCAAATAAAC
CGCCGTCTCAATGTGCTTCCGAAAAAGCCATTTCAGCAACGCAGCTCACGCGCAATATTCAGCCCGTCTC
ACCCGATATTTATCAACAAGCGCCGGAAGTAGTCCGTTACGGTCGTTATATCCTGGTAAGTACCGACCCA
ACAGCAGCACAGCGTGATCCGCTTTCCCAATTGATTGAGGTTCATATTCCGGCGTCTCAGCATCCCACGG
TAGCCGATGCCCTGCGTGACGTATTACGCCAGTCGGGTTATCGGTTATGTGCGCCTGAAAAAACCAATGA
CATTTTATATCGCCAGCCGTTGCCGTCTGTGCACTATCAGTTAGGCCCTGTCCGGCTGCGTACCGCTTTG
CAGCTTATGGCAGGCCCGGCCTGGCAACTGGAGGTGGATGAGGTGCAACGTGAGGTTTGTCACCATTTGC
GGCCGGGTTATCAGCTTCCACAACCCCGGCAGGGAAAGCAGCCATGA
 Primer design