SecReT4
Protein ID: 290476363
T4SS name [ID]Tfc [698]
Gene symbol-
Locus tagXBJ1_3385
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T4SS(s) in this replicon]
Location [Strand]3298861..3299559 [+]
Producthypothetical protein
Component typeTfc3
UniProt IDD3V4C4
KEGG IDxbo:XBJ1_3385
PDB IDNA
Domain hit(s) vs Pfam NA
Protein Sequence: 232 a.a.     [Download]
>gi|290476363|ref|YP_003469267.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MRLHQIGLVTWIVLISPTWAATPSPLTSQQAHTVESQKQTLRIQAGQWGLSTDEYRRYQQLLNGPRGIQS
PGLDPLTTLGIEAESDAERRRYAEQWVKAEFARTEKELRFQREVDAAWQRLFPDMLPVNMEKSGEAKGRL
ALFVKINDCPPCDARLAEVLALMQPIDIYLVDSKGNDDTLRQWAKKHRIPVERVRNRHITLNHDAGYWFR
FGQGIMPILLRQGEQGWQITSL
 
Nucleotide Sequence: 699 bp     [Download]
>gi|290473094|ref|NC_013892.1|:3298861-3299559 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGAGATTACATCAAATCGGTCTGGTAACGTGGATAGTGCTCATCAGCCCAACATGGGCAGCCACACCGT
CACCCTTAACGTCGCAGCAGGCACATACGGTGGAAAGCCAAAAGCAAACATTGAGAATACAGGCCGGGCA
ATGGGGATTGAGCACGGATGAATATCGGCGTTATCAGCAATTATTGAATGGTCCAAGGGGAATTCAGTCG
CCGGGGCTTGATCCGTTGACAACCCTGGGGATTGAAGCTGAAAGTGATGCAGAACGCCGCCGTTATGCTG
AGCAGTGGGTCAAAGCGGAATTTGCCCGCACTGAAAAAGAACTGCGTTTTCAGCGGGAAGTGGATGCCGC
CTGGCAACGATTATTTCCGGATATGTTGCCGGTCAATATGGAGAAATCCGGTGAGGCAAAGGGGCGTTTG
GCGTTGTTTGTCAAAATCAACGATTGCCCGCCGTGTGACGCCCGTTTAGCGGAAGTTCTGGCATTGATGC
AACCGATTGACATTTATCTGGTCGACAGCAAGGGCAATGATGACACACTACGGCAATGGGCCAAAAAACA
CCGTATCCCCGTTGAACGGGTACGCAACCGACACATCACATTGAATCATGATGCGGGGTACTGGTTCCGG
TTCGGGCAGGGCATCATGCCGATTTTATTACGGCAGGGAGAGCAGGGATGGCAAATCACATCATTATGA
 Primer design