SecReT4
Protein ID: 290476364
T4SS name [ID]Tfc [698]
Gene symbol-
Locus tagXBJ1_3386
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T4SS(s) in this replicon]
Location [Strand]3299538..3300077 [+]
Producthypothetical protein
Component typeTfc5
UniProt IDD3V4C5
KEGG IDxbo:XBJ1_3386
PDB IDNA
Domain hit(s) vs Pfam DUF2859 [PF11072], Evalue: 2.9e-50, Aligned region: 31..173
Protein Sequence: 179 a.a.     [Download]
>gi|290476364|ref|YP_003469268.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MANHIIMKRLSVFPVIGLLWISACHAELNIIADLGGKDASPFYESINAEQRDEPVSSVQNSSPEMAGEAA
MLPVKTLELTPGKVSSRPLQLPGIGALFLIGDDPGSRRWLSQNAATLTKLHAVGLVVNVREMAGLQSLRA
LAPDLLLSPASGTELARRLQLQHYPVLITETQLSQQLSP
 
Nucleotide Sequence: 540 bp     [Download]
>gi|290473094|ref|NC_013892.1|:3299538-3300077 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGGCAAATCACATCATTATGAAACGGCTGAGTGTATTTCCCGTTATCGGCCTGTTATGGATAAGTGCCT
GCCATGCTGAACTGAACATCATTGCCGATTTAGGCGGCAAAGATGCCTCGCCTTTTTATGAAAGCATTAA
TGCTGAGCAACGCGATGAGCCTGTGTCATCGGTGCAAAATTCCTCACCTGAAATGGCAGGTGAAGCGGCG
ATGTTGCCTGTCAAAACACTGGAGCTGACGCCGGGAAAAGTGTCAAGCAGACCACTGCAATTGCCGGGAA
TTGGGGCACTGTTTCTGATTGGGGATGATCCCGGTTCACGCCGGTGGTTAAGCCAGAATGCGGCCACATT
GACGAAACTGCATGCTGTGGGTCTGGTCGTCAATGTCAGGGAAATGGCGGGTTTGCAGTCACTGCGGGCA
TTGGCACCGGATTTATTGTTATCGCCTGCTTCCGGCACCGAGCTGGCTCGTCGATTGCAACTGCAACATT
ATCCGGTGTTGATCACGGAAACTCAACTTTCCCAACAGTTATCACCATGA
 Primer design