SecReT4
Protein ID: 290476365
T4SS name [ID]Tfc [698]
Gene symbol-
Locus tagXBJ1_3387
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T4SS(s) in this replicon]
Location [Strand]3300074..3302137 [+]
Productplasmid transfer protein
Component typeTfc6
UniProt IDD3V4C6
KEGG IDxbo:XBJ1_3387
PDB IDNA
Domain hit(s) vs Pfam TraG-D_C [PF12696], Evalue: 3.5e-16, Aligned region: 504..632
TrwB_AAD_bind [PF10412], Evalue: 1.9e-15, Aligned region: 180..225
TrwB_AAD_bind [PF10412], Evalue: 1.9e-15, Aligned region: 489..642
AAA_10 [PF12846], Evalue: 6.2e-13, Aligned region: 187..579
Protein Sequence: 687 a.a.     [Download]
>gi|290476365|ref|YP_003469269.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MSRHYVVEALLRPAVELNTAVVSVVAAFVCIRAPWAIALAPSVSYVMAGGFAVLAMIRTWQGIQVIRYRR
NLRRLPRYQMSTRQIPVSHRQLFLGRGFRWQQKHTQRLQDTRRPEVERFVQPSQAYQLARALERRTEYRW
PALSALLRKDSPFNPVRPLPPVGGNPALHGIEPQETDVFMDLRERVGHTLVMGTTRVGKTRLAELLITQD
IRRGEVVIVFDPKGDADLLRRIWAEAHRAGRGNELSLFHLGWPEISARYNAVGRFGRVSEVASRLAGQLS
GEGNSAAFREFAWRFVNIVARALVALGHRPDYQLITRYVNNISELYQRYATRMMEERQPDLLAQINHSLS
KLKEKDIPRNMQGQPDALRLWAMEMTLSSDAGKQLYDPILDGLRSAVRYDRTYFDKIVASLLPLLEKLTT
GKIAELLSPDYLNMADLRPIFDWEQVIRKNGIVYIGLDALSDSDVASAVGNSMFADLVSVAGQIYKYGMN
AGLPVRHDGKLAINLHCDEFNELMGDEFIPLINKGGGAGMQVTAYTQTSSDIEARIGSMAKTAQVIGNFN
TLIMLRVRDNRTAELLTSQLPEVEIYSKTLVSGHSDIADVEQGQDFTSSTQDRVGTVKTPLITPAEMINL
PKGQAFALLEGGQLWKIRMPLPTGDDDDALMPANLQNIAEQMRRHYRTSENWWEEKG
 
Nucleotide Sequence: 2064 bp     [Download]
>gi|290473094|ref|NC_013892.1|:3300074-3302137 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGAGCCGCCATTATGTGGTTGAAGCCCTGCTGCGTCCTGCCGTCGAGCTGAATACTGCGGTGGTCTCAG
TCGTTGCGGCTTTTGTCTGTATCAGGGCGCCTTGGGCCATCGCACTGGCACCTTCAGTCAGCTATGTCAT
GGCAGGCGGTTTTGCCGTACTGGCAATGATACGCACATGGCAGGGTATTCAGGTCATCCGTTATCGCAGA
AACCTGCGTCGCCTGCCACGTTACCAGATGAGCACCAGGCAAATTCCCGTCAGTCACCGGCAGTTGTTTC
TGGGCAGGGGATTTCGCTGGCAACAGAAGCATACCCAGCGTTTGCAGGATACGCGACGACCGGAGGTCGA
ACGATTTGTGCAACCGTCTCAGGCTTATCAGCTTGCCCGCGCACTGGAGCGTCGAACTGAATACCGTTGG
CCGGCATTATCTGCGCTATTACGCAAAGACTCGCCATTTAATCCGGTACGTCCGCTGCCACCAGTGGGCG
GTAATCCGGCACTCCACGGGATTGAACCACAGGAGACTGATGTTTTTATGGATCTGCGCGAACGGGTCGG
GCATACGCTGGTGATGGGGACTACCCGTGTGGGAAAAACCCGGCTGGCTGAACTGCTTATCACGCAGGAT
ATCCGGCGCGGTGAAGTGGTGATCGTCTTTGATCCCAAAGGCGACGCTGATCTGTTAAGGCGCATTTGGG
CAGAAGCGCACCGCGCGGGTCGCGGCAATGAACTGTCCCTCTTTCATCTGGGCTGGCCGGAGATTTCGGC
GCGTTATAACGCCGTCGGGCGGTTTGGCCGGGTGTCCGAAGTGGCTTCCCGTCTGGCCGGTCAGCTCAGC
GGCGAAGGCAACAGCGCCGCGTTCCGTGAATTTGCCTGGCGGTTTGTCAATATTGTTGCCCGAGCTTTGG
TGGCTCTGGGGCATCGGCCGGATTACCAGCTCATCACCCGCTACGTCAATAATATCAGCGAACTGTATCA
GCGCTATGCCACCCGAATGATGGAGGAAAGACAGCCGGATCTGCTGGCGCAAATCAATCATTCCCTCAGC
AAACTGAAAGAAAAAGACATTCCGCGCAATATGCAGGGGCAACCCGATGCCCTCCGGCTCTGGGCGATGG
AAATGACGCTGAGTTCTGACGCAGGCAAGCAACTCTATGACCCGATTCTGGATGGTCTGCGTTCTGCCGT
GCGTTATGACCGTACCTATTTTGATAAAATTGTCGCGTCCTTATTGCCGCTGCTGGAGAAACTGACCACA
GGCAAAATTGCGGAATTATTGTCACCGGATTATCTCAATATGGCGGATCTGCGTCCTATCTTCGACTGGG
AACAGGTGATCCGCAAAAATGGGATTGTCTATATCGGGCTGGATGCGCTGTCTGACAGTGATGTGGCCTC
GGCGGTAGGCAACAGCATGTTTGCAGATTTGGTCAGTGTCGCCGGGCAAATTTACAAATATGGCATGAAC
GCCGGATTGCCGGTACGTCATGACGGTAAGCTAGCGATTAACCTGCATTGTGATGAATTCAATGAACTGA
TGGGCGATGAATTTATTCCGCTGATTAATAAAGGTGGCGGCGCGGGCATGCAGGTGACGGCATATACCCA
GACCTCCTCCGATATCGAGGCCCGTATCGGCAGCATGGCCAAAACGGCGCAGGTGATAGGTAACTTCAAC
ACTTTGATTATGTTGCGTGTGCGGGATAACCGGACGGCAGAACTTCTCACCAGCCAGCTGCCGGAAGTGG
AAATCTACAGTAAGACCCTGGTATCGGGGCATTCAGATATTGCTGATGTTGAACAGGGGCAGGATTTTAC
CTCGTCCACACAAGATAGGGTAGGCACCGTCAAAACACCACTAATTACGCCCGCTGAAATGATTAACTTG
CCGAAAGGGCAGGCGTTTGCGTTATTGGAAGGTGGGCAGTTGTGGAAAATCCGTATGCCTTTGCCAACGG
GAGATGACGATGATGCTCTGATGCCGGCCAATTTGCAGAACATCGCTGAACAGATGCGCAGGCACTACCG
CACCAGTGAAAATTGGTGGGAAGAGAAGGGGTAG
 Primer design