SecReT4
Protein ID: 290476366
T4SS name [ID]Tfc [698]
Gene symbol-
Locus tagXBJ1_3388
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T4SS(s) in this replicon]
Location [Strand]3302147..3302905 [+]
Producthypothetical protein
Component typeTfc8
UniProt IDD3V4C7
KEGG IDxbo:XBJ1_3388
PDB IDNA
Domain hit(s) vs Pfam DUF4400 [PF14348], Evalue: 2.6e-72, Aligned region: 50..249
Protein Sequence: 252 a.a.     [Download]
>gi|290476366|ref|YP_003469270.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MAQSENPSRQSSQPPRKHGLLYRLLWEWPWQLIGFMVMSWLFSLLLEYLGMAFFWPEQGAAHSQNMMKTE
LNYLSSEFTRSLLLSEPSQTVSAGLAQAYQWLFVDSGFMNWVQGQSQYQFHSRNDFMRELNSVLQGVSGY
LQEYWLATVFITMVTLIRLVILLLYVPLFVMVILVALVDGLGRRDLRRYGAGYESSFVYHHAKRGIKPAC
TVPCVLYLSWPNVVYPMVILLPAALFLGMAVVITTSMFKKYL
 
Nucleotide Sequence: 759 bp     [Download]
>gi|290473094|ref|NC_013892.1|:3302147-3302905 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGGCTCAATCAGAAAATCCCTCCCGTCAATCTTCCCAACCGCCCCGCAAGCATGGCCTGTTGTATCGTC
TGTTATGGGAATGGCCGTGGCAACTTATTGGGTTTATGGTGATGTCCTGGCTATTCAGCCTGTTACTGGA
ATATCTCGGTATGGCTTTTTTCTGGCCGGAACAGGGCGCCGCTCACAGTCAGAACATGATGAAGACAGAG
CTTAACTATCTCTCCTCAGAATTTACCCGAAGTCTGTTGCTGTCAGAACCCTCACAAACCGTTTCGGCAG
GGTTGGCGCAAGCCTATCAATGGCTGTTTGTGGACAGTGGTTTTATGAACTGGGTTCAGGGACAATCACA
ATATCAGTTCCATAGCCGTAATGATTTTATGCGTGAATTAAATTCCGTATTACAGGGTGTATCGGGCTAT
TTGCAAGAATATTGGCTGGCCACGGTGTTTATCACGATGGTGACGCTGATCCGACTGGTAATTTTGTTGT
TATACGTACCCTTATTTGTGATGGTGATTTTGGTGGCACTGGTTGACGGGCTGGGACGTCGGGACTTACG
ACGTTACGGAGCCGGGTATGAATCCAGTTTTGTCTATCACCATGCCAAGCGAGGGATAAAACCGGCCTGC
ACGGTTCCCTGTGTACTGTATTTATCGTGGCCGAATGTGGTGTATCCTATGGTGATATTGTTGCCAGCAG
CGCTATTTTTAGGTATGGCAGTGGTGATCACCACATCGATGTTTAAAAAGTATTTATAG
 Primer design