SecReT4
Protein ID: 290476369
T4SS name [ID]Tfc [698]
Gene symbol-
Locus tagXBJ1_3391
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T4SS(s) in this replicon]
Location [Strand]3304706..3305032 [+]
Producthypothetical protein
Component typeTfc9
UniProt IDD3V4D0
KEGG IDxbo:XBJ1_3391
PDB IDNA
Domain hit(s) vs Pfam Plasmid_RAQPRD [PF09686], Evalue: 4e-22, Aligned region: 24..103
Protein Sequence: 108 a.a.     [Download]
>gi|290476369|ref|YP_003469273.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MHGYFSLSRSACLLSLILMCVPIAQAAEKDELASAKNLIEQVQMALERANLAEKQADTPTRPRYDFDYLR
IKADLNTIKSGIDHYLTPSRAQQQESNVLSGHYRQERP
 
Nucleotide Sequence: 327 bp     [Download]
>gi|290473094|ref|NC_013892.1|:3304706-3305032 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGCACGGTTACTTTTCCCTGTCCCGTTCTGCCTGTCTGCTGAGTCTGATCCTGATGTGTGTACCGATTG
CGCAGGCGGCCGAGAAAGACGAACTGGCGAGTGCAAAAAATCTGATTGAGCAGGTGCAGATGGCACTGGA
GCGCGCAAACCTCGCTGAAAAGCAGGCTGACACCCCAACCCGCCCTCGCTATGACTTTGATTACCTCCGT
ATCAAAGCGGATCTCAACACCATTAAATCCGGTATTGATCACTACCTGACCCCTTCCCGCGCCCAGCAGC
AGGAATCAAACGTGTTATCCGGTCATTACCGTCAGGAACGCCCGTAA
 Primer design