SecReT4
Protein ID: 290476372
T4SS name [ID]Tfc [698]
Gene symbol-
Locus tagXBJ1_3394
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T4SS(s) in this replicon]
Location [Strand]3305692..3306066 [+]
Producthypothetical protein
Component typeTfc11
UniProt IDD3V4D3
KEGG IDxbo:XBJ1_3394
PDB IDNA
Domain hit(s) vs Pfam DUF3487 [PF11990], Evalue: 1e-41, Aligned region: 1..118
Protein Sequence: 124 a.a.     [Download]
>gi|290476372|ref|YP_003469276.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MQTIPFLPDRLNAEPVVFRGFTTPEMGLAALLGLAFGLMVSLPFIPLAGWVMIPTGMLFMPLLLISFGGR
WLAQLKRGKPENYLWLTLEEKKRRLGIGDPALIIAAQGWSLRRSRLTHRNGSLR
 
Nucleotide Sequence: 375 bp     [Download]
>gi|290473094|ref|NC_013892.1|:3305692-3306066 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGCAGACGATCCCGTTTTTACCCGATCGCTTAAATGCCGAACCGGTCGTATTTCGCGGATTCACCACAC
CGGAAATGGGGCTGGCCGCTTTGCTGGGGCTGGCATTCGGGTTGATGGTGAGCCTTCCTTTTATCCCGTT
AGCCGGCTGGGTCATGATACCGACGGGTATGCTGTTCATGCCCTTGTTATTGATTAGTTTTGGCGGTCGC
TGGCTCGCTCAGCTTAAGCGCGGCAAACCGGAAAATTATCTCTGGCTGACACTGGAAGAGAAAAAACGCC
GGCTGGGTATCGGTGATCCGGCATTGATTATTGCGGCTCAGGGTTGGTCGTTGCGTCGAAGCAGGCTGAC
TCATCGTAACGGGAGCCTGCGATGA
 Primer design