SecReT4
Protein ID: 290476373
T4SS name [ID]Tfc [698]
Gene symbol-
Locus tagXBJ1_3395
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T4SS(s) in this replicon]
Location [Strand]3306063..3306719 [+]
Producthypothetical protein
Component typeTfc12
UniProt IDD3V4D4
KEGG IDxbo:XBJ1_3395
PDB IDNA
Domain hit(s) vs Pfam DUF2895 [PF11444], Evalue: 2.2e-91, Aligned region: 5..203
Protein Sequence: 218 a.a.     [Download]
>gi|290476373|ref|YP_003469277.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MSRFRHALKNRDQHILTLRLVCGVLILVLLITLTGWMTSPRSLTIHNPPDLRSGSTRPWWEVPAPSVYSF
AFYLFQQLNAWPKNGAQDYPAKIAALSPYLTPACQDFLQEDAKTRADSGELLDRVRVVYEIPGRGYGTKS
VTVRNRDNWVVRLDLVADEYYHAEPVKRALVRYSLKVVRWEGDAERNPFGLALDCYDRMPQRLEAMPQPV
EEKKGVFQ
 
Nucleotide Sequence: 657 bp     [Download]
>gi|290473094|ref|NC_013892.1|:3306063-3306719 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGAGCCGGTTTCGTCATGCGCTGAAAAACCGTGACCAGCATATTCTGACCCTGCGGCTTGTCTGCGGGG
TGCTGATACTGGTCTTGCTGATTACGCTCACGGGCTGGATGACGTCACCGCGTAGTCTCACCATCCATAA
TCCGCCGGACTTACGCAGCGGCAGCACCCGCCCGTGGTGGGAAGTGCCTGCGCCGAGTGTCTACAGTTTT
GCCTTTTATCTTTTCCAGCAACTGAACGCCTGGCCGAAAAACGGGGCACAGGACTACCCGGCTAAAATTG
CGGCTTTGTCGCCTTACCTGACCCCCGCCTGTCAGGATTTTTTGCAGGAGGATGCCAAAACCCGGGCCGA
CAGTGGTGAGCTGCTTGATCGGGTGCGGGTGGTGTATGAGATCCCCGGCCGGGGCTACGGGACGAAAAGT
GTGACGGTGCGTAACCGGGATAACTGGGTGGTGCGGCTGGATTTGGTGGCCGATGAATATTATCACGCCG
AGCCGGTCAAACGGGCGCTGGTGCGCTATTCCCTGAAAGTGGTGCGCTGGGAGGGCGATGCGGAGCGTAA
TCCTTTCGGGCTGGCACTGGATTGTTACGACAGGATGCCGCAGCGTCTGGAAGCGATGCCGCAACCTGTG
GAAGAGAAAAAGGGGGTGTTCCAATGA
 Primer design