SecReT4
Protein ID: 290476374
T4SS name [ID]Tfc [698]
Gene symbol-
Locus tagXBJ1_3396
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T4SS(s) in this replicon]
Location [Strand]3306716..3307552 [+]
Producthypothetical protein
Component typeTfc13
UniProt IDD3V4D5
KEGG IDxbo:XBJ1_3396
PDB IDNA
Domain hit(s) vs Pfam DUF3438 [PF11920], Evalue: 7.1e-109, Aligned region: 15..272
Protein Sequence: 278 a.a.     [Download]
>gi|290476374|ref|YP_003469278.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MKRYPSCSSACFWLGLVSLVLFSLGAKADELMKWERIPLSIALKVGQERIIFADRNVRVGLSPSLSDKLR
VQSAGGAIYLKASQSFPSTRLQLQDSENGEIILLDITATKTGPTEPVRILYPDEKNSVPKEGAPHQRKSA
PLAPAPVILTRYAAQQLYAPLRTVEPVTGIHPVSLHLPAAITTVYPSEPIAVSPLAGWGMQNYTVVALKL
RNTAKRNITLDPRALQGQFVAATFQHRWLGEAGTPEDTTVLYLVTRGQPDNAFIPEPVTVKPGGRHAG
 
Nucleotide Sequence: 837 bp     [Download]
>gi|290473094|ref|NC_013892.1|:3306716-3307552 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGAAAAGATATCCATCTTGCTCTTCTGCCTGTTTTTGGCTGGGATTGGTCAGCCTCGTGCTGTTCAGCC
TCGGTGCAAAGGCTGATGAACTGATGAAATGGGAACGCATTCCGTTATCCATTGCCCTCAAGGTAGGTCA
GGAGCGGATTATTTTCGCAGACAGAAATGTCCGTGTTGGTTTGTCTCCGTCACTCAGCGATAAACTGCGG
GTGCAGAGCGCAGGGGGAGCCATTTACCTGAAAGCCAGCCAATCTTTTCCGTCTACCCGTCTGCAATTGC
AGGACAGTGAAAACGGCGAAATTATCTTACTGGATATTACCGCCACCAAAACGGGGCCAACGGAACCCGT
CCGCATTCTTTATCCGGATGAAAAAAATTCTGTACCAAAAGAGGGGGCACCGCATCAGAGAAAATCAGCA
CCTTTGGCTCCCGCGCCTGTGATATTAACCCGCTATGCCGCTCAGCAGCTTTATGCCCCGCTGCGTACCG
TCGAGCCGGTTACGGGGATCCACCCGGTCAGTCTGCATTTACCCGCCGCCATCACCACCGTCTATCCGTC
GGAACCGATTGCGGTTTCCCCGCTGGCCGGCTGGGGCATGCAAAATTACACGGTGGTAGCCCTGAAACTG
CGTAATACGGCCAAACGCAACATTACGCTCGACCCACGAGCCTTGCAGGGGCAATTTGTCGCAGCAACGT
TTCAGCATCGTTGGCTGGGTGAAGCAGGGACACCGGAAGATACCACAGTGCTGTATCTTGTGACCCGAGG
ACAGCCGGATAATGCTTTTATCCCTGAGCCGGTAACAGTGAAACCGGGAGGCCGTCATGCAGGTTAA
 Primer design