SecReT4
Protein ID: 290476375
T4SS name [ID]Tfc [698]
Gene symbol-
Locus tagXBJ1_3397
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T4SS(s) in this replicon]
Location [Strand]3307542..3308972 [+]
Producthypothetical protein
Component typeTfc14
UniProt IDD3V4D6
KEGG IDxbo:XBJ1_3397
PDB IDNA
Domain hit(s) vs Pfam TrbI [PF03743], Evalue: 1.5e-07, Aligned region: 265..448
Protein Sequence: 476 a.a.     [Download]
>gi|290476375|ref|YP_003469279.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MQVKSNSLVKILVPMVLMVGGFIGIKSCSSTDTTAPDTPPNNVLATLSPEELQALGVGGDTPEDTLRTLV
GTLNKVRSEQQRLGQQNADILKENDQLKNQRQDVAGQIDAAVAAIRQDDEQRRRELQDEQQGLLAQIDLL
TERLNSAPLSAPDSPIPLGSGSIPYSANAGTGQNELIWITPADEKPADIQTPGSGKATAQFPTSFLSEQS
AAGQSKPQSPSLQNPSKEENEQPVYTLPENATLVGSQAMTALLGRVPVNGAVTDPYPFKILIGKDNLTAN
GIELPEVEGAVVSGSASGDWTLSCVRGQVNSITVVFQDGTVRTLPGSGQNNNTSANGIGWLSDENGIPCI
SGERKSNAATYLPTLFALSAMHSAGDALSESQRTAQTSGTGGITTALTGNAGQAALGKAMSGGMNDMSEW
LRQRYSQTFDAIYVPPGARVVVHITQRLAIDYETKGRKVRYGVREAAQRDNQEALD
 
Nucleotide Sequence: 1431 bp     [Download]
>gi|290473094|ref|NC_013892.1|:3307542-3308972 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGCAGGTTAAATCCAACAGTCTGGTGAAAATCCTGGTGCCGATGGTGCTGATGGTCGGCGGGTTTATCG
GCATCAAAAGTTGCAGCTCAACCGACACTACCGCGCCCGATACGCCACCCAACAATGTCCTGGCCACATT
GTCACCGGAGGAGTTACAGGCGCTGGGTGTCGGCGGTGATACGCCGGAAGATACCTTGCGTACGCTGGTG
GGAACACTCAATAAAGTGCGGTCAGAGCAGCAACGCTTAGGTCAGCAGAATGCCGATATCCTGAAAGAAA
ATGACCAGTTAAAAAATCAGCGTCAGGATGTCGCCGGTCAGATAGACGCGGCGGTGGCAGCTATCCGGCA
GGACGATGAACAGCGCCGGCGTGAATTACAGGATGAACAGCAGGGATTGCTGGCACAGATTGATTTACTG
ACGGAACGCTTAAATTCAGCGCCTTTGTCTGCGCCGGACAGTCCGATACCACTTGGGTCGGGAAGTATTC
CGTATTCTGCCAATGCAGGCACAGGGCAGAATGAACTTATCTGGATAACACCGGCCGATGAAAAGCCCGC
AGACATACAAACCCCCGGCAGTGGAAAAGCCACGGCGCAGTTCCCGACCTCATTTTTAAGTGAACAGTCA
GCCGCCGGGCAAAGTAAGCCCCAAAGCCCATCGCTTCAAAACCCATCAAAGGAAGAAAATGAACAGCCGG
TCTATACCCTGCCTGAAAATGCCACGTTAGTGGGCAGTCAGGCCATGACCGCGTTATTAGGCCGTGTTCC
CGTCAATGGTGCAGTGACTGACCCTTATCCATTCAAAATCCTTATCGGCAAAGACAACCTGACGGCCAAC
GGCATTGAACTGCCGGAGGTGGAAGGGGCGGTGGTGTCCGGCTCAGCCAGTGGCGACTGGACACTCTCCT
GCGTGCGCGGTCAGGTCAATTCCATCACGGTTGTTTTTCAGGATGGCACGGTGCGTACCCTGCCGGGCAG
CGGGCAAAACAACAATACCAGCGCGAACGGCATCGGCTGGCTGTCTGATGAAAACGGCATTCCCTGTATC
AGCGGTGAGCGCAAATCCAACGCCGCCACCTATCTGCCGACCCTGTTTGCGCTCTCGGCCATGCATTCGG
CCGGCGATGCCCTGAGTGAAAGTCAGCGTACTGCCCAGACCAGCGGCACAGGCGGTATCACCACCGCGTT
AACGGGCAATGCCGGACAGGCCGCATTGGGCAAAGCGATGTCAGGTGGCATGAATGACATGAGCGAATGG
CTCAGACAGCGCTACAGCCAGACGTTTGATGCGATTTACGTCCCGCCCGGTGCCCGTGTTGTGGTGCATA
TCACACAACGCCTGGCGATTGATTACGAAACGAAAGGACGTAAGGTGCGCTACGGCGTGCGTGAGGCCGC
CCAACGTGACAATCAGGAAGCATTAGATTAA
 Primer design