SecReT4
Protein ID: 290476378
T4SS name [ID]Tfc [698]
Gene symbol-
Locus tagXBJ1_3400
StrainXenorhabdus bovienii SS-2004
Repliconchromosome [GenBank: NC_013892] [Browse all T4SS(s) in this replicon]
Location [Strand]3309717..3312482 [+]
Producthypothetical protein
Component typeTfc16
UniProt IDD3V4D9
KEGG IDxbo:XBJ1_3400
PDB IDNA
Domain hit(s) vs Pfam TraC_F_IV [PF11130], Evalue: 1.1e-56, Aligned region: 25..297
AAA_10 [PF12846], Evalue: 1.1e-44, Aligned region: 490..834
Protein Sequence: 921 a.a.     [Download]
>gi|290476378|ref|YP_003469282.1| unnamed protein product [Xenorhabdus bovienii SS-2004]
MEKPKALNRPGKLREADETTIYHANPSIIDYLPWVEYLEDGQCLLLDDGISVGAVYQIESIATEGRPAER
LTEIRDQLEDAIQDSLEEDDISPWVVQFFCQDDDDPADYLNTLRGYVKPWAQGTLFTDAFLTESEHHLNS
IARPDGIFQDSLITGQPWRGQQRQTRMVVYRWLPDGRRSHVSNPALSAVAALNQVCERLVSSLASAGVIA
RRQHGGQIHSWLLRHFNPAPDWGMAKADFYHTVSYGTTTLSDLPVNNDFAESLWFTPPVSDPDAGVWWFD
GLPHKAVLVERLRRPPEPGTLTGEVKRGDNINTLMDMMPAGTVVSLTIVAQAQDRLEEDFTRLTKNAVGE
NTESLRVRQDVQEVKELLGRRHKLYRSALAFLVRGRDLDDINHRVHQLSSTLLTAGLQPVRPEFSVSPLN
AWLRALPMCFNPQKDKKHGYSRLTWVQHLAGLLPVTGRSTGTGHPGFSFFNRGGAPLTFDPMNKQDRTQN
AHLLLFGPTGAGKSATLCASLIQLMAVHRPRLFIVEAGNSFGLLADYYESLGLTVNKIGIRPGCGVSLAL
FADAHQLLKLSPKQLRINEADIPDTDEQQEEEGDEQRDILGEMEIAARLMITGGEKREEERLTRSDRGLI
REAIMMAAQTSFNEKRQMVASDLQNALYAIARNHRQDEHGQPLITAHRRARADEMASAMSMFTQGFEGEL
FNRPGTSWPEVDVTLIDLGTLARENYSAQMALAMVSLINKVNNLAERDQYQDRELQLVIDEGHITTTNPL
LSPYMTKVVKMWRKLGTWLWLATQNLADYPDTAEKMLNMAEWWLCLTMPPDEVEQIARFKKLTEEEKAVL
LSASKLPRCYTEGVVLAKKIEALFRVVPPSLYLALGMTEKEEKAERRALMREHQCSELEAAFLVARKMDI
ARGLKVDSGSV
 
Nucleotide Sequence: 2766 bp     [Download]
>gi|290473094|ref|NC_013892.1|:3309717-3312482 Xenorhabdus bovienii SS-2004 chromosome, complete genome
ATGGAAAAACCCAAGGCACTGAACCGTCCCGGTAAATTGCGTGAGGCGGATGAAACTACTATTTACCATG
CAAACCCTTCCATCATCGATTACCTGCCCTGGGTGGAATATCTGGAAGACGGGCAATGTTTATTGTTGGA
TGACGGGATTTCCGTCGGCGCGGTCTATCAGATTGAATCCATTGCCACCGAAGGCCGTCCCGCTGAGCGG
TTGACTGAAATCCGGGATCAACTGGAAGATGCGATCCAGGACAGTCTGGAAGAAGATGATATTTCGCCGT
GGGTGGTGCAGTTTTTTTGTCAGGATGACGATGATCCTGCTGACTATCTCAACACCTTGCGGGGCTATGT
GAAACCCTGGGCACAGGGAACACTGTTTACTGACGCCTTTCTGACGGAATCAGAGCATCACCTGAACAGC
ATTGCCCGGCCTGACGGGATATTTCAGGACAGCTTAATCACCGGGCAACCGTGGCGGGGCCAGCAACGCC
AGACCCGTATGGTGGTTTATCGGTGGCTGCCTGACGGGCGCAGATCCCATGTTAGCAATCCGGCCTTATC
AGCGGTGGCTGCGCTCAATCAGGTCTGCGAACGTCTGGTCTCGTCACTGGCTTCTGCCGGTGTGATTGCC
CGCCGACAACATGGCGGCCAGATCCACAGTTGGCTGTTACGTCACTTTAATCCGGCACCGGATTGGGGGA
TGGCAAAAGCCGATTTTTACCATACGGTGAGTTATGGTACCACCACCCTATCGGATCTCCCCGTCAACAA
TGACTTTGCTGAAAGCCTGTGGTTTACCCCGCCGGTGTCTGATCCCGACGCGGGCGTCTGGTGGTTTGAC
GGGTTACCGCATAAAGCGGTGCTGGTTGAGCGTCTGCGCCGTCCGCCGGAACCGGGAACACTGACAGGCG
AAGTGAAACGGGGCGACAATATCAATACTCTGATGGATATGATGCCGGCAGGGACGGTAGTTTCGCTGAC
CATTGTGGCGCAGGCACAGGACAGGCTGGAAGAGGATTTTACCCGGCTGACGAAAAATGCGGTGGGAGAA
AATACTGAATCGCTGCGCGTCCGGCAGGATGTGCAGGAAGTGAAAGAACTTCTGGGGCGGCGGCATAAAT
TGTACCGCAGTGCGCTGGCCTTTCTGGTGCGGGGCAGGGATCTGGATGATATAAACCACCGGGTACATCA
ATTATCCTCCACCCTGCTGACAGCCGGATTACAGCCCGTCCGGCCGGAATTCAGTGTGTCACCGCTGAAT
GCCTGGTTACGGGCACTGCCGATGTGCTTTAACCCGCAGAAAGACAAAAAACACGGGTACAGCCGCCTGA
CCTGGGTACAGCATCTGGCCGGGTTATTGCCGGTGACAGGTCGTTCGACCGGCACCGGGCATCCGGGGTT
CAGTTTCTTTAACCGGGGCGGGGCACCGCTGACCTTTGATCCGATGAACAAACAGGATCGCACCCAGAAT
GCCCATTTACTGCTGTTTGGTCCGACCGGCGCGGGGAAATCCGCCACCCTGTGCGCCTCGCTCATCCAGT
TAATGGCAGTACATCGGCCGCGTCTGTTTATTGTGGAGGCGGGAAACAGTTTTGGCTTGCTGGCCGATTA
CTATGAAAGTCTGGGGCTGACGGTCAATAAAATCGGTATCAGACCGGGTTGTGGCGTCAGTCTGGCGCTG
TTTGCCGATGCCCATCAACTGTTGAAACTGAGTCCCAAGCAATTGCGCATTAATGAAGCCGATATCCCCG
ATACCGATGAACAACAGGAAGAGGAGGGGGATGAACAGCGCGATATCCTGGGCGAAATGGAAATTGCCGC
CCGACTGATGATCACCGGTGGTGAGAAAAGAGAAGAAGAACGCCTGACCCGCTCTGATCGCGGTTTAATT
CGTGAGGCCATTATGATGGCGGCGCAGACCAGCTTTAACGAGAAACGCCAGATGGTGGCCTCGGATTTAC
AGAATGCCCTTTATGCCATCGCCCGTAATCACCGGCAGGATGAACACGGCCAGCCGTTAATCACCGCTCA
CCGACGGGCACGGGCAGATGAAATGGCCAGCGCCATGTCAATGTTTACACAAGGCTTTGAGGGTGAACTG
TTTAACCGCCCCGGTACGTCGTGGCCGGAAGTGGATGTCACCCTGATTGATTTGGGCACACTGGCACGGG
AGAACTACTCGGCGCAAATGGCACTGGCGATGGTGTCACTCATCAACAAAGTCAATAACCTGGCTGAACG
GGATCAATATCAGGATCGCGAACTGCAACTGGTGATTGATGAAGGACATATCACCACCACCAACCCGCTG
TTATCACCCTATATGACTAAAGTGGTCAAAATGTGGCGTAAACTGGGGACCTGGCTGTGGCTTGCCACCC
AAAACCTGGCGGATTACCCCGATACTGCTGAAAAGATGCTGAATATGGCTGAATGGTGGCTGTGTCTGAC
CATGCCACCGGATGAAGTGGAGCAAATCGCCCGGTTTAAGAAACTGACGGAAGAGGAAAAAGCCGTATTG
CTCTCTGCCAGCAAATTACCCCGTTGTTATACTGAAGGTGTGGTATTAGCGAAAAAAATCGAAGCCTTGT
TTCGGGTGGTGCCCCCAAGCCTGTATCTGGCGCTGGGGATGACGGAAAAAGAAGAAAAAGCCGAGCGTAG
GGCGTTAATGCGTGAACATCAGTGCAGTGAACTGGAAGCCGCTTTTCTGGTGGCCAGAAAAATGGATATC
GCACGGGGGTTAAAGGTTGATTCCGGTTCTGTATGA
 Primer design