SecReT4
Protein ID: 291286490
T4SS name [ID]Tra_F [602]
Gene symbol-
Locus tagDacet_0552
StrainDenitrovibrio acetiphilus DSM 12809
Repliconchromosome [GenBank: NC_013943] [Browse all T4SS(s) in this replicon]
Location [Strand]564166..564435 [+]
Producttype IV conjugative transfer system protein TraL
Component typeTraL_F
UniProt IDD4H439
KEGG IDdap:Dacet_0552
PDB IDNA
Domain hit(s) vs Pfam TraL [PF07178], Evalue: 5.9e-10, Aligned region: 4..87
Protein Sequence: 89 a.a.     [Download]
>gi|291286490|ref|YP_003503306.1| type IV conjugative transfer system protein TraL [Denitrovibrio acetiphilus DSM 12809]
MRSYVPQYLHKPVKIMMLDSDEFVILANGVLVGVLLKSIVLFILVLVIFFIYRKGKEKHPRGFFRHIPHM
LGLKQFRHFPNIFIRNFME
 
Nucleotide Sequence: 270 bp     [Download]
>gi|291285947|ref|NC_013943.1|:564166-564435 Denitrovibrio acetiphilus DSM 12809 chromosome, complete genome
ATGCGCTCATACGTCCCACAATATCTGCACAAACCCGTAAAAATCATGATGCTGGATTCTGATGAGTTCG
TGATCCTTGCAAATGGGGTGCTTGTCGGTGTTTTACTTAAAAGCATCGTGCTCTTTATATTAGTGCTGGT
CATATTCTTTATCTATAGAAAAGGTAAAGAAAAGCACCCCAGAGGCTTTTTCAGACACATCCCGCATATG
CTGGGGTTGAAGCAGTTCAGGCATTTTCCAAATATCTTTATTCGCAATTTTATGGAGTAG
 Primer design