SecReT4
Protein ID: 291286499
T4SS name [ID]Tra_F [602]
Gene symbol-
Locus tagDacet_0561
StrainDenitrovibrio acetiphilus DSM 12809
Repliconchromosome [GenBank: NC_013943] [Browse all T4SS(s) in this replicon]
Location [Strand]571911..572645 [+]
Productglutaredoxin
Component typeTraF_F
UniProt IDD4H448
KEGG IDdap:Dacet_0561
PDB IDNA
Domain hit(s) vs Pfam TraF [PF13728], Evalue: 2.3e-40, Aligned region: 33..238
Thioredoxin [PF00085], Evalue: 7.7e-07, Aligned region: 143..216
Protein Sequence: 244 a.a.     [Download]
>gi|291286499|ref|YP_003503315.1| glutaredoxin [Denitrovibrio acetiphilus DSM 12809]
MAKKRLLCFLIVLLALNGFCQSDKPFYKDKGHGWYNYEDPKPQSEKQLKDDYRKPVIDWKAVQIMHPDRL
NKLIEDVKDYALMFPSHENVKDYLKLQGVAIDRSREYMESFMYVVQTNPELSKENEIPTSKFGQDEKHRI
KVEKIEQTLAENRDKFALLYLYAPNCGYCAKQQPVLEYFVKDSGWQVKPVNIQQDQKAALNFNIAQTPSI
VLIRRDSPDWLLISSGIIAMSELKERIVRGLGLI
 
Nucleotide Sequence: 735 bp     [Download]
>gi|291285947|ref|NC_013943.1|:571911-572645 Denitrovibrio acetiphilus DSM 12809 chromosome, complete genome
ATGGCGAAAAAGAGACTGCTGTGCTTTCTGATTGTGCTTTTAGCACTGAATGGCTTTTGTCAGTCTGATA
AGCCATTTTATAAGGATAAAGGGCACGGCTGGTATAACTATGAAGACCCTAAACCACAATCAGAGAAACA
GTTGAAAGATGATTATAGAAAACCTGTAATTGACTGGAAGGCTGTGCAGATCATGCATCCTGATCGTTTA
AATAAGCTAATAGAGGATGTTAAGGACTACGCCCTTATGTTCCCTTCTCATGAGAATGTAAAGGACTATC
TCAAACTTCAGGGTGTTGCCATTGACCGCTCAAGGGAATATATGGAAAGCTTTATGTATGTGGTTCAGAC
TAATCCGGAGCTTTCAAAGGAAAATGAGATTCCTACATCGAAATTTGGTCAGGACGAAAAGCACCGGATA
AAGGTGGAGAAAATTGAACAGACTCTGGCTGAGAACAGAGACAAATTTGCTTTATTATATTTATATGCAC
CCAACTGCGGATATTGCGCAAAGCAGCAGCCGGTTCTGGAATATTTTGTTAAAGATTCCGGCTGGCAGGT
GAAACCAGTGAATATCCAGCAGGATCAGAAAGCGGCTCTGAATTTCAATATTGCCCAGACACCATCCATT
GTGCTTATACGCCGTGATTCACCTGACTGGCTTCTTATCTCCAGCGGAATAATTGCAATGTCAGAACTGA
AAGAAAGGATTGTCAGGGGTTTAGGATTAATTTAA
 Primer design